Tivoliaudio.us

Website Thumbnail
Checking...
Tivoli Audio

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-20
Category: This site has not been categorized yet

Tivoli Audio creates quality audio of uncompromising design. Shop the ART line, Model One BT, Model One Digital or clock, portable and bluetooth radios and speakers.


Domain summary

Domain label
tivoliaudio
Domain extension
us
Domain registered:
2000-07-24
Domain updated:
2020-10-20
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is tivoliaudio.us ranked relative to other sites:

Percentage of visits to tivoliaudio.us from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Tivoliaudio.us registered?
A: Tivoliaudio.us was registered 20 years, 4 months, 3 days, 4 hours, 58 minutes, 55 seconds ago on Monday, July 24, 2000.
Q: When was the WHOIS for Tivoliaudio.us last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 4 hours, 58 minutes, 55 seconds ago on Tuesday, October 20, 2020.
Q: What are Tivoliaudio.us's nameservers?
A: DNS for Tivoliaudio.us is provided by the following nameservers:
  • ns1mpz.name.com
  • ns3cpr.name.com
  • ns4fpy.name.com
  • ns2kry.name.com
Q: Who is the registrar for the Tivoliaudio.us domain?
A: The domain has been registered at NEUSTAR INC..
Q: What is the traffic rank for Tivoliaudio.us?
A: Tivoliaudio.us has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Tivoliaudio.us each day?
A: Tivoliaudio.us receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Tivoliaudio.us resolve to?
A: Tivoliaudio.us resolves to the IPv4 address 75.126.100.18.
Q: In what country are Tivoliaudio.us servers located in?
A: Tivoliaudio.us has servers located in the United States.
Q: What webserver software does Tivoliaudio.us use?
A: Tivoliaudio.us is powered by CloudFlare webserver.
Q: Who hosts Tivoliaudio.us?
A: Tivoliaudio.us is hosted by SoftLayer Technologies Inc. in Texas, Dallas, United States, 75244.
Q: How much is Tivoliaudio.us worth?
A: Tivoliaudio.us has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Tivoliaudio.us Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Tivoliaudio.us Free SEO Report

Website Inpage Analysis for Tivoliaudio.us

H1 Headings

0 :

H2 Headings

21 :
  1. ART Generation 2
  2. Limited Edition
  3. REVIVE
  4. MUSIC SYSTEM HOME
  5. Save on open box products
  6. Bestsellers
  7. Music System Home (Gen. 1)
  8. Model One Digital (Gen. 2)
  9. CUBE
  10. Andiamo
  11. Revive
  12. Model One BT
  13. Classic Collection
  14. Art Collection
  15. Go Collection
  16. The World of Tivoli
  17. Featured Stories: Touring a Crisp & Clean Scand...
  18. Featured Stories: The Contain Boutique and How ...
  19. Featured Stories: The Magazine That's Changing ...
  20. Night Stand: Touring the Hotel and Villa Auersp...
  21. Search

H3 Headings

7 :
  1. About
  2. Products
  3. Resources
  4. Like Being First?
  5. Age verification
  6. translation missing: en.general.search.label
  7. In Your Cart

H4 Headings

2 :
  1. This website is using cookies
  2. Main menu

H5 Headings

1 :
  1. Your cart is currently empty.

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

23 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-2624878-1

Links - Internal

63:
  1. Tivoliaudio Radios
    http://tivoliaudio.us/collections/radios
  2. Tivoliaudio Shop Radios
    http://tivoliaudio.us/collections/radios
  3. Tivoliaudio AM/FM Radios
    http://tivoliaudio.us/collections/radios/feature_AM%2FFM
  4. Tivoliaudio Clock Radios
    http://tivoliaudio.us/collections/radios/feature_clock
  5. Tivoliaudio Accessories
    http://tivoliaudio.us/collections/accessories
  6. Tivoliaudio Sale/Promotions
    http://tivoliaudio.us/collections/sale-promotions
  7. Tivoliaudio Outlet Shop
    http://tivoliaudio.us/collections/outlet-shop
  8. Tivoliaudio Wireless
    http://tivoliaudio.us/collections/wireless
  9. Tivoliaudio Shop Wireless
    http://tivoliaudio.us/collections/wireless
  10. Tivoliaudio Wi Fi
    http://tivoliaudio.us/collections/wireless/feature_wi-fi
  11. Tivoliaudio Bluetooth
    http://tivoliaudio.us/collections/wireless/feature_bluetooth
  12. Tivoliaudio Sale / Promotions
    http://tivoliaudio.us/collections/sale-promotions
  13. Tivoliaudio Portable
    http://tivoliaudio.us/collections/portables
  14. Tivoliaudio Shop Portables
    http://tivoliaudio.us/collections/portables
  15. Tivoliaudio Earbuds
    http://tivoliaudio.us/collections/portables/feature_Earbuds
  16. Tivoliaudio Radios
    http://tivoliaudio.us/collections/portables/feature_AM%2FFM
  17. Tivoliaudio Collections
    http://tivoliaudio.us/pages/all-collections
  18. Tivoliaudio Classic
    http://tivoliaudio.us/pages/classic-collection
  19. Tivoliaudio Art
    http://tivoliaudio.us/pages/art-collection
  20. Tivoliaudio Go
    http://tivoliaudio.us/pages/go-collection
  21. Tivoliaudio Shop All
    http://tivoliaudio.us/collections/all
  22. Tivoliaudio Combos
    http://tivoliaudio.us/collections/combos
  23. Tivoliaudio World of
    http://tivoliaudio.us/blogs/news
  24. Tivoliaudio Support
    http://tivoliaudio.us/pages/help
  25. Tivoliaudio Where to Buy
    http://tivoliaudio.us/pages/where-to-buy
  26. Tivoliaudio Contact
    http://tivoliaudio.us/pages/contact
  27. Tivoliaudio Product Manuals
    http://tivoliaudio.us/pages/product-manuals
  28. Tivoliaudio FAQ / Troubleshooting
    http://tivoliaudio.us/pages/help
  29. Tivoliaudio Warranty & Returns
    http://tivoliaudio.us/pages/warranty-returns
  30. Tivoliaudio Shipping Policy
    http://tivoliaudio.us/pages/shipping-policy
  31. http://tivoliaudio.us/account/login
    http://tivoliaudio.us/account/login
  32. Tivoliaudio (0) Cart
    http://tivoliaudio.us/cart
  33. Tivoliaudio Learn More
    http://tivoliaudio.us/pages/art-collection
  34. Tivoliaudio Learn More
    http://tivoliaudio.us/pages/limited-edition-tacko-andiamo-bluetooth-speakers
  35. Tivoliaudio Learn More
    http://tivoliaudio.us/products/revive-bluetooth-speaker-lamp-wireless-charger
  36. Tivoliaudio Learn More
    http://tivoliaudio.us/products/music-system-home-smart-hi-fi
  37. Tivoliaudio SHOP NOW
    http://tivoliaudio.us/collections/outlet-shop
  38. Tivoliaudio Music System Home (Gen. 1)  
    http://tivoliaudio.us/products/music-system-home-smart-hi-fi
  39. Tivoliaudio Model One Digital (Gen. 2)  
    http://tivoliaudio.us/products/model-one-digital-wifi-bluetooth-fm-radio-gen-2
  40. Tivoliaudio CUBE  
    http://tivoliaudio.us/products/cube-wireless-speaker
  41. Tivoliaudio Andiamo  
    http://tivoliaudio.us/products/andiamo
  42. Tivoliaudio Revive  
    http://tivoliaudio.us/products/revive-bluetooth-speaker-lamp-wireless-charger
  43. Tivoliaudio Model One BT  
    http://tivoliaudio.us/products/model-one-bluetooth-am-fm-radio
  44. http://tivoliaudio.us/pages/classic-collection
    http://tivoliaudio.us/pages/classic-collection
  45. http://tivoliaudio.us/pages/art-collection
    http://tivoliaudio.us/pages/art-collection
  46. http://tivoliaudio.us/pages/go-collection
    http://tivoliaudio.us/pages/go-collection
  47. Tivoliaudio News blog posts
    http://tivoliaudio.us/blogs/news
  48. Tivoliaudio Featured Stories: Touring a Crisp & Clean Scand...
    http://tivoliaudio.us/blogs/news/featured-stories-touring-a-crisp-clean-scandinavian-home-in-the-netherlands
  49. Tivoliaudio Featured Stories: The Contain Boutique and How ...
    http://tivoliaudio.us/blogs/news/featured-story-tivoli-audio-in-new-zealand-getting-to-know-the-contain-boutique
  50. Tivoliaudio Featured Stories: The Magazine That's Changing ...
    http://tivoliaudio.us/blogs/news/the-progressive-magazine-changing-up-the-male-dominated-mobility-magazine-industry
  51. Tivoliaudio Night Stand: Touring the Hotel and Villa Auersp...
    http://tivoliaudio.us/blogs/news/night-stand-hotel-and-villa-auersperg
  52. Tivoliaudio DISCOVER MORE
    http://tivoliaudio.us/blogs/news
  53. Tivoliaudio Our Company
    http://tivoliaudio.us/pages/about
  54. Tivoliaudio Where to buy
    http://tivoliaudio.us/pages/where-to-buy
  55. Tivoliaudio Hospitality
    http://tivoliaudio.us/pages/hospitality
  56. Tivoliaudio Blogs
    http://tivoliaudio.us/blogs/news
  57. Tivoliaudio Portables
    http://tivoliaudio.us/collections/portables
  58. Tivoliaudio Privacy & Legal
    http://tivoliaudio.us/pages/privacy-legal
  59. Tivoliaudio Customer Support
    http://tivoliaudio.us/pages/help
  60. Tivoliaudio Shipping
    http://tivoliaudio.us/pages/shipping-policy
  61. Tivoliaudio Prop 65
    http://tivoliaudio.us/pages/california-proposition-65
  62. Tivoliaudio Privacy Policy
    http://tivoliaudio.us/pages/privacy-policy
  63. Tivoliaudio Continue shopping
    http://tivoliaudio.us/collections/all

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Tivoliaudio.us

foundfalsedocumentgetelementsbytagnamehead0appendchildstermsswatchimage cdnshopifycomsfiles1037547901059t2assetsswatchcherrymetallictaupe100xpngv7991850520010046865whitegreycolorname blackashsilver imageddd swatchimageportablereplacementeimagecolorname whitesilver imagewalnutgrey imageminussettimeoutfunctionswatchcolor ddd swatchimagelearnmorepage nulldategettimeswatchimageallfalse elseurlcdnshopifycomsfiles1037547901059t2assetsswatchwhitegrey100xpngv8647523237467092612 colornamedocumentcreateelementscriptreplacement antennaswatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblackashblack100xpngv15995725305087623351 colornameandiamowhitesilver imagenew dategettimecontinuesupplyswatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnutbeige100xpngv8235252416929392164 colornametivoli audiocdnshopifycomsfiles1037547901059t2assetsswatchblackashblack100xpngv15995725305087623351 colornamecdnshopifycomsfiles1037547901059t2assetsswatchwalnutgrey100xpngv4097029319124963208 colorname blackashblackcdnshopifycomsfiles1037547901059t2assetsswatchblackashblack100xpngv15995725305087623351translationcdnshopifycomsfiles1037547901059t2assetsswatchwalnutbeige100xpngv8235252416929392164cartshopddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwhitegrey100xpngv8647523237467092612replacement antenna learnmorepageswatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnutgrey100xpngv4097029319124963208 colornameoutlet shopcolorname blackashblack imagetranslation missingvariantsddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnutbeige100xpngv8235252416929392164elcarticondatacolorname whitegreycolor colorname walnutbeigefeatured storiesnullsessionstcallartblackashsilvernewtivolinull variants colorworldcollectionpower supplyvarbluetoothencartgeneralreducequantity translationsubtitleswatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnutbeige100xpngv8235252416929392164colorname walnutgreycatch echerrymetallictaupe imageencartgeneralincreasequantitysearchsupportswatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwhitegrey100xpngv8647523237467092612 colornamenews featured storiesswatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblackashsilver100xpngv7921601390169386518 colornamenull variantstruewalnutbeigeblackashblack imagescriptshippingoutletsubtitle null learnmorepagesubtitle nullvariants color colornamepositiontrianglecdnshopifycomsfiles1037547901059t2assetsswatchwalnutgrey100xpngv4097029319124963208colorname whitesilverreplacement powersubtitle replacementcolorname blackashblacksubtitle replacement powertryddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblackashblack100xpngv15995725305087623351supply learnmorepagemissing encartgeneralreducequantity translationsafaribrowsercompatibilityddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchcherrymetallictaupe100xpngv7991850520010046865color colorname walnutgreyaudiocdnshopifycomsfiles1037547901059t2assetsswatchwalnutgrey100xpngv4097029319124963208 colorname whitegreyaccessoriescolorname walnutgrey imageminus translationantenna learnmorepage nullvariants colorbcsffiltermainconfiglearnmorepagereplacement power supplywirelessproductsswatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwhitesilver100xpngv14160649712468777002sessionstcall falsestoriessystem1whitegrey imageyoureachencartgeneralreducequantityfeaturedcolorname walnutbeigecdnshopifycomsfiles1037547901059t2assetsswatchblackashsilver100xpngv7921601390169386518 colornameswatchcolor dddoct in newscatchwindowsessionstoragegeojscodetxtcolor colornamesection1566456250311functioncolorname cherrymetallictaupe imagecdnshopifycomsfiles1037547901059t2assetsswatchwalnutbeige100xpngv8235252416929392164 colornamenewsddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwhitesilver100xpngv14160649712468777002dddblackashsilver imagecolorname blackashsilverwhitesilvertempscripttxtyoumissing encartgeneralreducequantityswatchcolorcdnshopifycomsfiles1037547901059t2assetsswatchwhitesilver100xpngv14160649712468777002power supply learnmorepagenews featuredcolorname cherrymetallictaupecherrymetallictaupestorageprototypesetitemifcolornamecdnshopifycomsfiles1037547901059t2assetsswatchblackashsilver100xpngv7921601390169386518 colorname whitesilversubtitle replacement antennacdnshopifycomsfiles1037547901059t2assetsswatchwhitegrey100xpngv8647523237467092612 colorname blackashblack0collectionsnbspantennablackashblacklearnmorepage null variantsbcsffilterconfigantenna learnmorepageswatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblackashsilver100xpngv7921601390169386518null learnmorepagewifimorecolorencartgeneralreducequantity translation missingwebsitemissingnull learnmorepage nullelsesupply learnmorepage nullresultstranslation missing encartgeneralincreasequantitycdnshopifycomsfiles1037547901059t2assetsswatchwhitegrey100xpngv8647523237467092612results for termsupdateproductsubtitlewalnutgreypowercolorname walnutbeige imageswatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblackashblack100xpngv15995725305087623351swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwhitegrey100xpngv8647523237467092612radioscdnshopifycomsfiles1037547901059t2assetsswatchwalnutgrey100xpngv4097029319124963208 colornameddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnutgrey100xpngv4097029319124963208swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnutgrey100xpngv4097029319124963208colorname whitegrey imageminus translation missingcdnshopifycomsfiles1037547901059t2assetsswatchblackashsilver100xpngv7921601390169386518walnutbeige imagemissing encartgeneralincreasequantityoctlearnmediawinboomrlcdnshopifycomsfiles1037547901059t2assetsswatchcherrymetallictaupe100xpngv7991850520010046865ddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblackashsilver100xpngv7921601390169386518safaribrowsercompatibility falsenotourtranslation missing encartgeneralreducequantitycdnshopifycomsfiles1037547901059t2assetsswatchblackashblack100xpngv15995725305087623351 colorname whitegreylearn moreelse ifhome

Longtail Keyword Density for Tivoliaudio.us

KeywordsOccurences
swatchcolor ddd swatchimage63
subtitle null learnmorepage24
learnmorepage null variants21
variants color colorname20
ddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-black100xpngv1599572530508762335112
ddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwhite-grey100xpngv864752323746709261212
color colorname walnut-grey12
colorname walnut-grey image12
ddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-grey100xpngv409702931912496320812
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-grey100xpngv4097029319124963208 colorname12
colorname white-grey image12
colorname black-ash-black image12
null learnmorepage null7
cdnshopifycomsfiles1037547901059t2assetsswatchwhite-grey100xpngv8647523237467092612 colorname black-ash-black6
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwhite-grey100xpngv8647523237467092612 colorname6
cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-grey100xpngv4097029319124963208 colorname white-grey6
cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-black100xpngv15995725305087623351 colorname white-grey6
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-black100xpngv15995725305087623351 colorname6
cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-grey100xpngv4097029319124963208 colorname black-ash-black6
colorname walnut-beige image5
ddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-silver100xpngv79216013901693865185
colorname black-ash-silver image5
ddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-beige100xpngv82352524169293921645
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-beige100xpngv8235252416929392164 colorname5
color colorname walnut-beige5
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-silver100xpngv7921601390169386518 colorname4
subtitle replacement power4
colorname white-silver image4
ddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwhite-silver100xpngv141606497124687770024
antenna learnmorepage null4
null variants color4
replacement power supply3
subtitle replacement antenna3
ddd swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchcherry-metallic-taupe100xpngv79918505200100468653
supply learnmorepage null3
power supply learnmorepage3
replacement antenna learnmorepage3
oct in news3
colorname cherry-metallic-taupe image3
cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-silver100xpngv7921601390169386518 colorname white-silver3
news featured stories3
translation missing encartgeneralincreasequantity3
encartgeneralreducequantity translation missing3
missing encartgeneralreducequantity translation3
translation missing encartgeneralreducequantity3
minus translation missing3
results for terms3
swatchcolor ddd63
ddd swatchimage63
null learnmorepage24
subtitle null24
null variants21
learnmorepage null21
variants color20
color colorname20
colorname white-grey12
black-ash-black image12
cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-grey100xpngv4097029319124963208 colorname12
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-grey100xpngv409702931912496320812
white-grey image12
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwhite-grey100xpngv864752323746709261212
walnut-grey image12
colorname walnut-grey12
colorname black-ash-black12
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-black100xpngv1599572530508762335112
translation missing9
subtitle replacement9
cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-black100xpngv15995725305087623351 colorname6
cdnshopifycomsfiles1037547901059t2assetsswatchwhite-grey100xpngv8647523237467092612 colorname6
colorname walnut-beige5
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-beige100xpngv82352524169293921645
cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-beige100xpngv8235252416929392164 colorname5
colorname black-ash-silver5
black-ash-silver image5
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-silver100xpngv79216013901693865185
walnut-beige image5
cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-silver100xpngv7921601390169386518 colorname4
colorname white-silver4
white-silver image4
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchwhite-silver100xpngv141606497124687770024
replacement power4
antenna learnmorepage4
learn more4
new dategettime4
else if3
colorname cherry-metallic-taupe3
replacement antenna3
supply learnmorepage3
power supply3
safaribrowsercompatibility false3
swatchimage cdnshopifycomsfiles1037547901059t2assetsswatchcherry-metallic-taupe100xpngv79918505200100468653
cherry-metallic-taupe image3
catch e3
sessionstcall false3
missing encartgeneralincreasequantity3
outlet shop3
news featured3
featured stories3
tivoli audio3
minus translation3
missing encartgeneralreducequantity3
encartgeneralreducequantity translation3
false else3
url67
swatchcolor65
colorname65
image65
swatchimage65
ddd63
null48
subtitle39
learnmorepage39
variants39
if27
color20
var20
function15
cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-grey100xpngv409702931912496320812
cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-black100xpngv1599572530508762335112
white-grey12
cdnshopifycomsfiles1037547901059t2assetsswatchwhite-grey100xpngv864752323746709261212
walnut-grey12
black-ash-black12
else11
shop9
replacement9
missing9
translation9
false9
terms8
you8
radios8
all7
products7
safaribrowsercompatibility6
each6
wireless6
nbsp6
your6
support6
true5
data5
system5
more5
cdnshopifycomsfiles1037547901059t2assetsswatchblack-ash-silver100xpngv79216013901693865185
audio5
05
news5
black-ash-silver5
cdnshopifycomsfiles1037547901059t2assetsswatchwalnut-beige100xpngv82352524169293921645
walnut-beige5
new5
e5
settimeoutfunction4
white-silver4
windowsessionstoragegeojscodetxt4
documentgetelementsbytagnamehead0appendchilds4
dategettime4
sessionstcall4
cdnshopifycomsfiles1037547901059t2assetsswatchwhite-silver100xpngv141606497124687770024
tempscripttxt4
bcsffilterconfig4
bluetooth4
tivoli4
power4
wi-fi4
antenna4
learn4
home4
collections4
cart4
art4
script3
results3
bcsffiltermainconfig3
positiontriangle3
elcarticon3
updateproductsubtitle3
cdnshopifycomsfiles1037547901059t2assetsswatchcherry-metallic-taupe100xpngv79918505200100468653
supply3
cherry-metallic-taupe3
accessories3
minus3
documentcreateelementscript3
featured3
portable3
shipping3
world3
search3
13
section--15664562503113
andiamo3
winboomrl3
collection3
oct3
stories3
media3
our3
website3
continue3
outlet3
encartgeneralreducequantity3
encartgeneralincreasequantity3
not3
storageprototypesetitem3
catch3
try3
found3

Who hosts Tivoliaudio.us?

Tivoliaudio.us Hosting Provider Information

Hosted IP Address:75.126.100.18
Hosted Hostname:12.64.7e4b.ip4.static.sl-reverse.com
Service Provider:SoftLayer Technologies Inc.
Hosted Country:United StatesUS
Location Latitude:32.9379
Location Longitude:-96.8384
Webserver Software:CloudFlare

Is "SoftLayer Technologies Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
SoftLayer Technologies Inc.
0.9626%

HTTP Header Analysis for Tivoliaudio.us

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 20 Oct 2020 22:46:06 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Sorting-Hat-PodId: 130
X-Sorting-Hat-ShopId: 37547901059
X-Storefront-Renderer-Rendered: 1
Location: https://tivoliaudio.com/
X-Frame-Options: DENY
Content-Security-Policy: frame-ancestors 'none';
X-ShopId: 37547901059
X-ShardId: 130
Vary: Accept
X-Shopify-Stage: production
X-Dc: gcp-us-central1,gcp-us-central1,gcp-us-central1
X-Request-ID: 5d6c1b75-ea4b-40f4-a9cd-cc39b430567f
X-Download-Options: noopen
X-Permitted-Cross-Domain-Policies: none
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
NEL: {"report_to":"network-errors","max_age":2592000,"failure_fraction":0.01,"success_fraction":0.0001}
Report-To: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifycloud.com/v1/reports/nel/20190325/shopify"}]}
CF-Cache-Status: DYNAMIC
cf-request-id: 05e9ca00d5000007721e2af000000001
Server: cloudflare
CF-RAY: 5e5645e159630772-LHR
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Tivoliaudio.us Domain Nameserver Information

HostIP AddressCountry
ns1mpz.name.com 163.114.216.17
ns3cpr.name.com 162.88.61.49
ns4fpy.name.com 163.114.217.49
ns2kry.name.com 163.114.216.49


Need to find out who hosts Tivoliaudio.us?


Domain Registration (WhoIs) information for Tivoliaudio.us

 Domain Name: tivoliaudio.us
Registry Domain ID: D13506973-US
Registrar WHOIS Server:
Registrar URL: www.name.com
Updated Date: 2020-07-06T18:16:43Z
Creation Date: 2007-07-24T19:34:08Z
Registry Expiry Date: 2021-07-23T23:59:59Z
Registrar: Name.com, Inc.
Registrar IANA ID: 625
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.7203101849
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C13506972-US
Registrant Name: Tivoli Audio LLC
Registrant Organization: Tivoli Audio LLC
Registrant Street: 745 ATLANTIC AVE 3RD FL
Registrant Street: 3rd Floor
Registrant Street:
Registrant City: Boston
Registrant State/Province: MA
Registrant Postal Code: 02211-0001
Registrant Country: US
Registrant Phone: +1.6173450358
Registrant Phone Ext:
Registrant Fax: +1.6174280088
Registrant Fax Ext:
Registrant Email: Login to show email
Application Purpose: P1
Registrant Nexus Category: C21
Registry Admin ID: C13506972-US
Admin Name: Tivoli Audio LLC
Admin Organization: Tivoli Audio LLC
Admin Street: 745 ATLANTIC AVE 3RD FL
Admin Street: 3rd Floor
Admin Street:
Admin City: Boston
Admin State/Province: MA
Admin Postal Code: 02211-0001
Admin Country: US
Admin Phone: +1.6173450358
Admin Phone Ext:
Admin Fax: +1.6174280088
Admin Fax Ext:
Admin Email: Login to show email
Application Purpose: P1
Admin Nexus Category: C21
Registry Tech ID: C13506972-US
Tech Name: Tivoli Audio LLC
Tech Organization: Tivoli Audio LLC
Tech Street: 745 ATLANTIC AVE 3RD FL
Tech Street: 3rd Floor
Tech Street:
Tech City: Boston
Tech State/Province: MA
Tech Postal Code: 02211-0001
Tech Country: US
Tech Phone: +1.6173450358
Tech Phone Ext:
Tech Fax: +1.6174280088
Tech Fax Ext:
Tech Email: Login to show email
Application Purpose: P1
Tech Nexus Category: C21
Name Server: ns4fpy.name.com
Name Server: ns2kry.name.com
Name Server: ns3cpr.name.com
Name Server: ns1mpz.name.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-08-18T02:31:29Z

Websites with Similar Names

Tivola-ventures.com
tivola-ventures.com
Tivoli-audio.dk
Tivoli Audio – Tivoli Audio Nordic
Tivoli-audio.fr
Tivoli Audio – Tivoli Audio EU
Tivoli-bcn.com
Tivoli-Bcn
Tivoli-kf.ru
Детские Новогодние подарки 2021 | Тиволи | Москва и МО
Tivoli-online.com
???????-????????? TimeWeb.ru | ?? ???? ?????????????? ??? ????? ????? ????????!
Tivoli-properties.com
Tivoli Properties, Inc - Innovation, Not Repetition
Tivoli-rochelais.com
→ Tivoli Rochelais, location de tentes, structures, chapiteaux, mobilier, matériel de réception et chauffage à La Rochelle
Tivoli-ug.net
IMWUC : External Home Page
Tivoli-yoga.com
Tivoli Yoga – Das Yoga-Studio im Herzogpark

Recently Updated Websites

Sulamadunyasi.com.tr 2 seconds ago.Vestedbeauty.com 4 seconds ago.Panamacanalboattour.com 5 seconds ago.Berlinticketsinternational.com 5 seconds ago.Productphotographersmumbai.com 5 seconds ago.Fsroom.ru 5 seconds ago.Tatkalsoftwarenow.com 5 seconds ago.Womenontheverge.net 6 seconds ago.Rsvpme.in 7 seconds ago.Enanjoujereduislegaspi.fr 7 seconds ago.Truetechservices.in 7 seconds ago.Phuthinhsolar.com 7 seconds ago.Thewanderinn.com 8 seconds ago.Stpierredeclairac.fr 9 seconds ago.Whatshigh.com 10 seconds ago.Terui-eco.co.jp 10 seconds ago.Laconfrerie.ca 10 seconds ago.Ashtonsclassicbarbers.com 10 seconds ago.Sosiedesigns.com 11 seconds ago.Santamonica.ed.cr 12 seconds ago.Sneb22.com 12 seconds ago.Chenguoliang.net 13 seconds ago.Trustgtcar.net 14 seconds ago.Trajetoriacultural.com.br 14 seconds ago.Tampon-encreur.org 15 seconds ago.Homeshareireland.ie 15 seconds ago.Windshieldwonderllc.com 16 seconds ago.Sarvasyaindia.in 17 seconds ago.Usako.net 17 seconds ago.Ilwu40.org 17 seconds ago.