Tlaer.org Favicon Tlaer.org

Tlaer.org Website Thumbnail
Checking...
TLAER
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
tlaer
Domain extension
org
Domain registered:
2004-01-15
Domain updated:
2020-09-15
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is tlaer.org ranked relative to other sites:

Percentage of visits to tlaer.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Tlaer.org registered?
A: Tlaer.org was registered 16 years, 8 months, 1 week, 4 days, 21 hours, 40 minutes, 24 seconds ago on Thursday, January 15, 2004.
Q: When was the WHOIS for Tlaer.org last updated?
A: The WHOIS entry was last updated 1 week, 4 days, 21 hours, 40 minutes, 24 seconds ago on Tuesday, September 15, 2020.
Q: What are Tlaer.org's nameservers?
A: DNS for Tlaer.org is provided by the following nameservers:
  • ns02.domaincontrol.com
  • ns01.domaincontrol.com
Q: Who is the registrar for the Tlaer.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Tlaer.org?
A: Tlaer.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Tlaer.org each day?
A: Tlaer.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Tlaer.org resolve to?
A: Tlaer.org resolves to the IPv4 address 50.63.209.1.
Q: In what country are Tlaer.org servers located in?
A: Tlaer.org has servers located in the United States.
Q: What webserver software does Tlaer.org use?
A: Tlaer.org is powered by Apache webserver.
Q: Who hosts Tlaer.org?
A: Tlaer.org is hosted by GoDaddy.com, LLC in Arizona, Scottsdale, United States, 85260.
Q: How much is Tlaer.org worth?
A: Tlaer.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Tlaer.org?

Tlaer.org Hosting Provider Information

Hosted IP Address:50.63.209.1
Hosted Hostname:p3nlhg330c1330.shr.prod.phx3.secureserver.net
Service Provider:GoDaddy.com, LLC
Hosted Country:United StatesUS
Location Latitude:33.6013
Location Longitude:-111.8867
Webserver Software:Apache

Is "GoDaddy.com, LLC" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Tlaer.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 15 Sep 2020 20:49:59 GMT
Server: Apache
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 11309
Content-Type: text/html

Tlaer.org Domain Nameserver Information

HostIP AddressCountry
ns02.domaincontrol.com 173.201.68.1
ns01.domaincontrol.com 97.74.100.1


Need to find out who hosts Tlaer.org?


WhoIs information for Tlaer.org

 Domain Name: TLAER.ORG
Registry Domain ID: D103800192-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2019-01-10T15:47:04Z
Creation Date: 2004-01-15T15:33:08Z
Registry Expiry Date: 2028-01-15T15:33:08Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Domains By Proxy, LLC
Registrant State/Province: Arizona
Registrant Country: US
Name Server: NS01.DOMAINCONTROL.COM
Name Server: NS02.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-07T23:07:45Z

Tlaer.org Free SEO Report

Website Inpage Analysis for Tlaer.org

H1 Headings

3 :
  1. BLOG (or see logo at top of page)
  2.    FACEBOOK TLAER GROUP (or see logo at top of page) 
  3. Other presenter's presentations are available at: https://www.bartacic.org/uc-davis-incidents-involving-animals-conference-2017 

H2 Headings

10 :
  1. TLAERTM COURSE DESCRIPTIONS
  2. ----------------
  3. ----------------
  4. Individuals can attend an AWARENESS Level Course as a Participant to receive a TLAER, Inc. Awareness Level Certification.  This is the MOST IMPORTANT level to attend for most people – from owners, veterinarians, and fire fighters to animal control / humane officers and law enforcement officers.
  5. THE SIXTH INTERNATIONAL CONFERENCE ON LARGE ANIMAL RESCUE was held in PRAGUE, CZECHOSLOVAKIA on 4-6 DEC 2015.  Mover and shakers from 12 countries in TLAER / LAR / LART / SART / DART, etc. came together. 
  6. DOWNLOAD the LEGACIES TO PROGRESS presentation Rebecca gave : https://www.bartacic.org/wp-content/uploads/2017/11/Rebecca-Gimenez-Legacies-to-Progress-Building-Community.pdf   
  7. the BARTA sponsored "Incidents Involving Animals: Managing Risk - Meeting Societal Needs" conference in UC Davis Vet School, California. October 2017.
  8. -------------------------------------
  9. 2013 saw the FIFTH INTERNATIONAL CONFERENCE ON LARGE ANIMAL RESCUE in Adelaide, AUSTRALIA - for YOUTUBE videos of the conference and speakers (including many of our colleagues and instructors) please see:
  10. (Hey - we saved you flying 15 hours to get there - plus hotel and car fees and food - and if you are involved in TLAER you should know what is going on around the world! This is your CHANCE to get updated before the next class or conference.)

H3 Headings

5 :
  1. www.youtube.com/watch?v=VagmZHzSrHk   20 Years of Large Animal Rescue, Rebecca Gimenez, USA
  2. www.youtube.com/watch?v=pB68WcnCbiQ   Multi Agency Coordination in Large Animal Rescues - Jim Green from the UK
  3. www.youtube.com/watch?v=y4OHjLZHyjY   Large Animal Transport OVERVIEW - Rebecca Gimenez, USA
  4. www.youtube.com/watch?v=F7J1Umo8c2k   Keynote - Overview of Large Animal Rescue in UK - Jim Green, UK
  5. All the other lectures from this conference are on the HORSE SA channel at  www.youtube.com/channel/UC-smsuELWJP3opP5dlAO1qA  

H4 Headings

1 :
  1. Based on NFPA 1006 and 1670 Standards, and including Best Practices from the NFPA 150 Standard (for which Rebecca is on the Technical Committee) and Incident Command System (ICS).  The TLAER courses range from the AWARENESS level of 16 hours classroom instruction and hands-on demonstrations to the Operations level courses which covers Awareness concepts and in 24 hours of technical instruction featuring hands on training with live animals, including horses and sometimes other large animals (depending on venue). The Syllabus covers the use of physical and chemical restraint, manipulations of large animals, vertical lifts, use of rescue ropes and knots in TLAER, prevention and response to a variety of scenarios from barn fires, mud and water rescue, among other situations on the highway with loose animals and trailer wrecks. Operational sessions include a nighttime basic search and rescue exercise with use of the Rescue Glide. This training covers natural disasters as well as local emergencies, and teaches simple techniques that can be applied to all large animals in scenarios such as ON YOUR FARM to on the highway to within a disaster response.  These Courses can be tailored to a variety of students - and normally include a mix of Law enforcement, ACO, Firefighters, USAR team members, Emergency Management, Veterinarians and Technicians, and of course horse and cattle owners and Industry members.  DETAILS BELOW.....

H5 Headings

0 :

H6 Headings

1 :
  1. (  Scope. 1.1.1* This standard shall identify and establish levels of functional capability for conducting operations at technical search and rescue incidents while minimizing threats to rescuers. A.1.1.1 This standard was developed to define levels of preparation and operational capability that should be ​ achieved by any authority having jurisdiction (AHJ) that has responsibility for technical rescue operations. These defined levels provide an outline of a system used to manage an incident efficiently and effectively, to maximize personnel safety, and to bring about the successful rescue of victims and the eventual termination of the event. The system should be followed to increase the capabilities of the AHJ to deal successfully with even the most complex incident. The system progresses from the simple basic awareness level to the operations level, and, finally, to the technician level. It should be understood that, as the system expands, the requirements for training, operational skills, management ability, and types and amounts of equipment also expand. 1.1.2* The requirements of this standard shall apply to organizations that provide response to technical search and rescue incidents, including those not regulated by governmental mandates. A.1.1.2 Organizations providing such rescue, fire suppression, and emergency services can include fire departments, law enforcement, emergency medical services, and utility, public works, and rescue organizations. 1.1.3* It is not the intent of this document to be applied to individuals and their associated skills and/or qualifications. A.1.1.3 While organizations can meet the requirements of this standard, individuals and their skills and qualifications are outside of the scope of this document. NFPA1006, Standard for Technical Rescuer Professional Qualifications, addresses rescue technician professional qualifications.)

Total IFRAMEs

0 :

Total Images

23 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

7:
  1. No text
    http://tlaer.org/index.html
  2. No text
    http://tlaer.org/store.html
  3. No text
    http://tlaer.org/instructors.html
  4. No text
    http://tlaer.org/schedule.html
  5. No text
    http://tlaer.org/resources.html
  6. No text
    http://tlaer.org/gallery.html
  7. No text
    http://tlaer.org/links.html

Links - Internal (nofollow)

0:

Links - Outbound

27:
  1. BLOG
    http://cs.thehorse.com/blogs/horse-911-whats-your-emergency/default.aspx
  2. FACEBOOK TLAER GROUP
    https://www.facebook.com/groups/tlaer/
  3. http://www.horsenation.com/2015/04/03/friday-standing-ovation-technical-large-animal-emergency-rescue/
    http://www.horsenation.com/2015/04/03/friday-standing-ovation-technical-large-animal-emergency-rescue/
  4. https://www.facebook.com/groups/tlaer/
    https://www.facebook.com/groups/tlaer/
  5. http://www.nfpa.org/codes-and-standards/document-information-pages?mode=code&code=1670
    http://www.nfpa.org/codes-and-standards/document-information-pages?mode=code&code=1670
  6. http://www.equineguelph.ca/news/index.php?content=426
    http://www.equineguelph.ca/news/index.php?content=426
  7. https://www.columbiamissourian.com/news/local/teamwork-leads-to-successful-large-animal-rescues/article_5e8483f2-11fe-11e5-b4d7-c7a7a985d2d9.html
    https://www.columbiamissourian.com/news/local/teamwork-leads-to-successful-large-animal-rescues/article_5e8483f2-11fe-11e5-b4d7-c7a7a985d2d9.html
  8. http://www.amazon.com/Technical-Large-Animal-Emergency-Rescue/dp/0813819989
    http://www.amazon.com/Technical-Large-Animal-Emergency-Rescue/dp/0813819989
  9. http://www.training.fema.gov/IS/
    http://www.training.fema.gov/IS/
  10. http://www.training.fema.gov/EMIWeb/IS/IS100b.asp
    http://www.training.fema.gov/EMIWeb/IS/IS100b.asp
  11. http://training.fema.gov/EMIWeb/IS/is111a.asp
    http://training.fema.gov/EMIWeb/IS/is111a.asp
  12. http://training.fema.gov/EMIWeb/IS/is10a.asp
    http://training.fema.gov/EMIWeb/IS/is10a.asp
  13. http://training.fema.gov/EMIWeb/IS/IS11a.asp
    http://training.fema.gov/EMIWeb/IS/IS11a.asp
  14. https://www.bartacic.org/wp-content/uploads/2017/11/Rebecca-Gimenez-Legacies-to-Progress-Building-Community.pdf
    https://www.bartacic.org/wp-content/uploads/2017/11/Rebecca-Gimenez-Legacies-to-Progress-Building-Community.pdf
  15. https://www.bartacic.org/uc-davis-incidents-involving-animals-conference-2017
    https://www.bartacic.org/uc-davis-incidents-involving-animals-conference-2017
  16. www.youtube.com/watch?v=VagmZHzSrHk
    https://www.youtube.com/watch?v=VagmZHzSrHk
  17. www.youtube.com/watch?v=pB68WcnCbiQ
    https://www.youtube.com/watch?v=pB68WcnCbiQ
  18. www.youtube.com/watch?v=y4OHjLZHyjY
    https://www.youtube.com/watch?v=y4OHjLZHyjY
  19. www.youtube.com/watch?v=F7J1Umo8c2k
    http://www.youtube.com/watch?v=F7J1Umo8c2k
  20. www.youtube.com/channel/UC-smsuELWJP3opP5dlAO1qA  
    http://www.youtube.com/channel/UC-smsuELWJP3opP5dlAO1qA
  21. http://www.telegraph.co.uk/news/worldnews/australiaandthepacific/australia/9111117/Horse-trapped-for-three-hours-in-mud-as-tide-approached.html
    http://www.telegraph.co.uk/news/worldnews/australiaandthepacific/australia/9111117/Horse-trapped-for-three-hours-in-mud-as-tide-approached.html
  22. www.4HoovesSMART.com
    https://l.facebook.com/l.php?u=http%3A%2F%2Fwww.4HoovesSMART.com%2F%3Ffbclid%3DIwAR06j3eMAyP-guQWyP7OA-B_Mx50aKvhHHRbNzSAi4S1azGv2pe9Ssoet08&h=AT3G3YeUZ-3sBkQ8REU8LM2bcELGfpIWrQbk_fBFPU3FQ1ONUjaJrOjRRl08jxqnXCdyG6cme5Iq8gJUGrvUY3dYBcqCne75aQ6IcZyriLnfbwQVCEj3374Op7vvTgFShJxemyN9vwqQYIaSVSg
  23. https://4hoovessmart.com/online-store?olsPage=products&page=6
    https://4hoovessmart.com/online-store?olsPage=products&page=6&fbclid=IwAR0MX-mZDVyvZ4NwdDBpla7u_-DRTJl63RTZCCXr0Jvch2QFs0-se8ibmd0
  24. Justin Mcleod
    https://www.facebook.com/jmcleodncff?fref=gs&__tn__=%2CdK-R-R&eid=ARD74u-qtyotxStnBQe3xH24piEBA_INhcd-07M-4EyO6keIphVaNli4O5Jz5Sn-tGl1poRi_PEvLLVw&dti=73737036701&hc_location=group
  25. Tori Miller McLeod
    https://www.facebook.com/ToriMillerMcLeod?fref=gs&__tn__=%2CdK-R-R&eid=ARBlF5WopWXbEs02DZh_q4aRbmEsCu26eXm8NAQIgSX-SH24NMLlW49KB9qn7ag5GkkRIJPco-5cuWGx&dti=73737036701&hc_location=group
  26. https://www.facebook.com/pages/Randy-Horse-Rescue-Mannequin/110014909076784?ref=ts&fref=ts
    https://www.facebook.com/pages/Randy-Horse-Rescue-Mannequin/110014909076784?ref=ts&fref=ts
  27. TLAER STUDY GROUP 
    https://www.facebook.com/groups/tlaer/

Links - Outbound (nofollow)

2:
  1. www.4HoovesSMART.com
    https://l.facebook.com/l.php?u=http%3A%2F%2Fwww.4HoovesSMART.com%2F%3Ffbclid%3DIwAR06j3eMAyP-guQWyP7OA-B_Mx50aKvhHHRbNzSAi4S1azGv2pe9Ssoet08&h=AT3G3YeUZ-3sBkQ8REU8LM2bcELGfpIWrQbk_fBFPU3FQ1ONUjaJrOjRRl08jxqnXCdyG6cme5Iq8gJUGrvUY3dYBcqCne75aQ6IcZyriLnfbwQVCEj3374Op7vvTgFShJxemyN9vwqQYIaSVSg
  2. https://4hoovessmart.com/online-store?olsPage=products&page=6
    https://4hoovessmart.com/online-store?olsPage=products&page=6&fbclid=IwAR0MX-mZDVyvZ4NwdDBpla7u_-DRTJl63RTZCCXr0Jvch2QFs0-se8ibmd0

Keyword Cloud for Tlaer.org

operations levelhorsegetdrlargefireincludingresponseconferenceinternationalstoreattendincreaseinstructorssuchrescueveterinariansanimalanimalscoursesavailablesomedr rebeccalivestockmemberstheyshouldemailproceduresmcleodonlinelevel coursemanagementnbspbringukinstructedlarge animal rescuepublictechniquesincgroupcoursestudentslevelsmethodslawnotstandardtransportotherawarenesstheirtogetherincidentcancertificationdepartmentstheselarge animalsheavyequipmenttechnical largetlaertmrebeccaownlocaltlaer incorganizationslarge animaltypesnbspthedo notemergency servicesownersdotrainingfbpagethosepleaseindividualsusarwebsitebasicoperationalanyskillsevenyourhighlyallundertlaerservicesearchcoversnbspnbspnbspnbspeachwetlaer coursesteamsdr rebecca gimenezrebecca gimenezrescue operationsablewhilehorsessimplelarge animal emergencyhasnfpahavetechnicalthemworldoverrealisticbeingrequirementsaround the worldleveldifferentmostyouvetndasharoundgimenezlogotopenforcementlivesearch and rescueemergency rescuenbsp nbsp nbspanimal emergencyanimal rescueemergencyofficersmudincludetechnical rescuehoursusaservicesdoes notusedonline storetechnical large animalprovidenbsp nbspourreceivemoreseetechnicianspecializedqualificationslistedmannequinconference on largedisasterpeopleusenbspnbspinternational conferencescenariosmanywithinlaw enforcementveryanimal emergency rescueawareness levellastoperationssystemfreedoesincidents

Longtail Keyword Density for Tlaer.org

KeywordsOccurences
nbsp nbsp nbsp28
large animal rescue7
search and rescue4
technical large animal3
large animal emergency3
animal emergency rescue3
around the world3
conference on large3
dr rebecca gimenez3
nbsp nbsp31
large animal23
tlaer inc14
animal rescue9
dr rebecca5
rebecca gimenez5
technical rescue5
operations level5
online store4
large animals4
law enforcement4
do not4
level course4
awareness level4
international conference3
technical large3
emergency services3
tlaer courses3
does not3
emergency rescue3
animal emergency3
rescue operations3
nbsp47
tlaer40
rescue33
animal30
large28
course21
not18
level16
inc16
training15
technical15
animals14
emergency14
you12
awareness12
courses11
operations11
our10
can9
equipment9
these9
rebecca9
online9
ndash9
services8
their8
standard8
have8
available7
organizations7
we7
conference7
tlaertm7
all7
fire7
other7
techniques7
incidents7
response7
incident7
your6
system6
use6
horse6
see6
disaster6
does6
logo5
any5
students5
those5
search5
individuals5
most5
instructors5
procedures5
live5
page5
people5
over5
please5
gimenez5
usa5
has5
such5
dr5
teams5
website5
types4
horses4
enforcement4
hours4
law4
get4
many4
attend4
realistic4
highly4
nbspnbspnbspnbsp4
do4
last4
uk4
own4
store4
qualifications4
scenarios4
technician4
departments4
certification4
nfpa4
owners4
veterinarians4
should4
members4
operational4
requirements4
local4
including4
some3
each3
more3
around3
world3
group3
methods3
listed3
free3
international3
mannequin3
provide3
email3
management3
bring3
officers3
mcleod3
fb3
top3
them3
together3
under3
include3
they3
receive3
nbspnbsp3
mud3
skills3
covers3
basic3
simple3
increase3
used3
within3
transport3
usar3
vet3
different3
while3
heavy3
nbspthe3
levels3
even3
specialized3
able3
service3
livestock3
being3
public3
very3
instructed3

Tlaer.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Tlaer.org is a scam?

Websites with Similar Names

Recently Updated Websites

Reformation.edu 2 seconds ago.Acervodasantigas.com 3 seconds ago.Pillarpm.com 3 seconds ago.Shmcdaemon.com 3 seconds ago.Plmeble.eu 3 seconds ago.Centraleyeworks.net 3 seconds ago.Expressiveposters.com 4 seconds ago.Ero-ks.org 4 seconds ago.Marketpro.top 5 seconds ago.Seemigo.com 6 seconds ago.Bladenvalleyfarm.com 6 seconds ago.Ebookpublishing101.com 6 seconds ago.Redhura.com 7 seconds ago.Themoststableprobiotic.com 7 seconds ago.Tailwatermarine.com 7 seconds ago.Shippingpostonline.com 7 seconds ago.Klttu.tw 7 seconds ago.Prbb.ru 7 seconds ago.Taikosummit.com 8 seconds ago.Littledoggy.ru 8 seconds ago.Fontania-am.com 8 seconds ago.Los-proyectos.com 8 seconds ago.Truthiscool.com 8 seconds ago.Stvol.ua 8 seconds ago.Kadaknath.com 9 seconds ago.Scansite4d.com 9 seconds ago.Poulsborunning.com 9 seconds ago.Promamo.com 9 seconds ago.Endorsementpro.com 10 seconds ago.Phialab.com 10 seconds ago.