Markenrecherche und Markenschutz - TMDB

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Kostenlose Markenrecherche, Markennamen prüfen im Markenregister DPMA (Deutschland), EUIPO (EU), WIPO (IR-Marken), IGE (Schweiz), ... Marken anmelden.



Domain summary

Last updated
2020-10-24
Domain label
tmdb
Domain extension
eu
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Tmdb.eu registered?
A: Tmdb.eu was registered 1 year, 3 months, 1 day, 17 hours, 31 minutes ago on Saturday, October 24, 2020.
Q: When was the WHOIS for Tmdb.eu last updated?
A: The WHOIS entry was last updated 1 year, 3 months, 1 day, 17 hours, 31 minutes ago on Saturday, October 24, 2020.
Q: What are Tmdb.eu's nameservers?
A: DNS for Tmdb.eu is provided by the following nameservers:
  • adam.ns.cloudflare.com
  • zoe.ns.cloudflare.com
Q: Who is the registrar for the Tmdb.eu domain?
A: The domain has been registered at EURID.
Q: What is the traffic rank for Tmdb.eu?
A: Tmdb.eu has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Tmdb.eu each day?
A: Tmdb.eu receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Tmdb.eu resolve to?
A: Tmdb.eu resolves to the IPv4 address 78.46.209.184.
Q: In what country are Tmdb.eu servers located in?
A: Tmdb.eu has servers located in the Germany.
Q: What webserver software does Tmdb.eu use?
A: Tmdb.eu is powered by Nginx/1.14.2 webserver.
Q: Who hosts Tmdb.eu?
A: Tmdb.eu is hosted by Hetzner Online GmbH in Germany.
Q: How much is Tmdb.eu worth?
A: Tmdb.eu has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Tmdb.eu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Tmdb.eu Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Tmdb.eu

H1 Headings

0 :

H2 Headings

3 :
  1. Kostenlose Markenrecherche in über 5 Millionen Marken
  2. Services zum Markenschutz
  3. Ihre Vorteile

H3 Headings

8 :
  1. Markenrecherche
  2. Markenanmeldung
  3. Markenüberwachung
  4. Markenverlängerung
  5. Top-Kanzlei für Markenanmeldungen
  6. TMDB
  7. Markenservices
  8. Top Kanzlei für Marken

H4 Headings

3 :
  1. Spezialisten für Markenrecht
  2. Direkter Ansprechpartner
  3. Transparente Preise

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-35949249-4

Links - Internal

38:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Tmdb.eu

anmeldenabmahnung gebhrenrechnermarkenschutzgegen marke markezuverteidigenkanzlei breuer lehmannwiderspruch gegendeutschlandinformierenkanzlei breuerbreuermarkenrecherche markeschtzen siestatistikenanmelden markenrecherchediemarkenanmeldungdeutschverteidigen abmahnunganmelden markenrecherche markeverlngern widerspruchmarkenrecherchewiderspruch gegen markelehmann rechtsanwltelehmannberwachen markenschutz verlngerngebhrenrechnerjetztmarke anmeldenfrverlngernberwachentrademarkmarkenanmeldungenvonverlngern widerspruch gegengegenmarkenrecherche marke berwachenberwachen markenschutzabmahnungbreuer lehmannmarke berwachenmarke gegen widerspruchihrensieverteidigen abmahnung gebhrenrechnergegen markekanzleischtzenenglishgegen widerspruch verteidigenmarke berwachen markenschutzmarkenanmeldungen vonmarkenschutz verlngern widerspruchmarke gegeneinerwiderspruchtopeumarkenschutz verlngerndergegen widerspruchmarke marke gegenrechtsanwltewiderspruch verteidigenmarkeihremitwiderspruch verteidigen abmahnungmarke marke

Longtail Keyword Density for Tmdb.eu

KeywordsOccurences
anmelden markenrecherche marke3
markenrecherche marke berwachen3
marke berwachen markenschutz3
berwachen markenschutz verlngern3
markenschutz verlngern widerspruch3
verlngern widerspruch gegen3
widerspruch gegen marke3
gegen marke marke3
marke marke gegen3
marke gegen widerspruch3
gegen widerspruch verteidigen3
widerspruch verteidigen abmahnung3
verteidigen abmahnung gebhrenrechner3
kanzlei breuer lehmann3
markenanmeldungen von5
marke gegen4
markenschutz verlngern4
gegen widerspruch3
breuer lehmann3
kanzlei breuer3
schtzen sie3
abmahnung gebhrenrechner3
verteidigen abmahnung3
widerspruch verteidigen3
marke anmelden3
anmelden markenrecherche3
marke marke3
gegen marke3
widerspruch gegen3
verlngern widerspruch3
berwachen markenschutz3
marke berwachen3
markenrecherche marke3
lehmann rechtsanwlte3
marke19
markenanmeldungen10
gegen8
der8
mit7
von7
zu7
markenrecherche6
markenschutz6
widerspruch6
kanzlei5
deutsch5
einer5
sie5
anmelden5
jetzt4
fr4
informieren4
ihre4
deutschland4
english4
lehmann4
verteidigen4
verlngern4
top4
die4
breuer3
rechtsanwlte3
schtzen3
ihren3
markenanmeldung3
eu3
statistiken3
gebhrenrechner3
abmahnung3
berwachen3
trademark3

Who hosts Tmdb.eu?

Tmdb.eu Hosting Provider Information

Hosted IP Address:78.46.209.184
Hosted Hostname:ctrl.tmdb.eu
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx/1.14.2

Is "Hetzner Online GmbH" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
Hetzner Online GmbH
0.4560%

HTTP Header Analysis for Tmdb.eu

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx/1.14.2
Date: Sat, 24 Oct 2020 20:38:31 GMT
Content-Type: text/html
Content-Length: 185
Connection: keep-alive
Location: https://tmdb.eu/

Tmdb.eu Domain Nameserver Information

HostIP AddressCountry
adam.ns.cloudflare.com 108.162.193.54
zoe.ns.cloudflare.com 173.245.58.149


Need to find out who hosts Tmdb.eu?


Domain Registration (WhoIs) information for Tmdb.eu

 % The WHOIS service offered by EURid and the access to the records
% in the EURid WHOIS database are provided for information purposes
% only. It allows persons to check whether a specific domain name
% is still available or not and to obtain information related to
% the registration records of existing domain names.
%
% EURid cannot, under any circumstances, be held liable in case the
% stored information would prove to be wrong, incomplete or not
% accurate in any sense.
%
% By submitting a query you agree not to use the information made
% available to:
%
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or
% otherwise;
% - target advertising in any possible way;
%
% - to cause nuisance in any possible way to the registrants by sending
% (whether by automated, electronic processes capable of enabling
% high volumes or other possible means) messages to them.
%
% Without prejudice to the above, it is explicitly forbidden to extract,
% copy and/or use or re-utilise in any form and by any means
% (electronically or not) the whole or a quantitatively or qualitatively
% substantial part of the contents of the WHOIS database without prior
% and explicit permission by EURid, nor in any attempt hereof, to apply
% automated, electronic processes to EURid (or its systems).
%
% You agree that any reproduction and/or transmission of data for
% commercial purposes will always be considered as the extraction of a
% substantial part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept
% that EURid can take measures to limit the use of its WHOIS services
% in order to protect the privacy of its registrants or the integrity
% of the database.
%
% The EURid WHOIS service on port 43 (textual whois) never
% discloses any information concerning the registrant.
% Registrant and on-site contact information can be obtained through use of the
% webbased WHOIS service available from the EURid website www.eurid.eu
%
% WHOIS tmdb.eu
Domain: tmdb.eu
Script: LATIN

Registrant:
NOT DISCLOSED!
Visit www.eurid.eu for webbased WHOIS.

On-site(s):
NOT DISCLOSED!
Visit www.eurid.eu for webbased WHOIS.

Registrar:
Name: domainfactory GmbH
Website: http://www.df.eu

Name servers:
adam.ns.cloudflare.com
zoe.ns.cloudflare.com

Please visit www.eurid.eu for more info.

Websites with Similar Names

Tmdb.de
Markenrecherche und Markenschutz - TMDB
Tmdb.eu
Markenrecherche und Markenschutz - TMDB
Tmdb.org
The Movie Database (TMDB)
Tmdb.tv
403 — Forbidden
Tmdb.xyz
The domain name Tmdb.xyz is for sale

Recently Updated Websites

Kaleidos.tech (1 second ago.)Emondesign.com (3 seconds ago.)Bruetsch-gruppe.de (4 seconds ago.)Gudang-toyota.com (5 seconds ago.)9608365.com (6 seconds ago.)Jsfengxiang.com (7 seconds ago.)Hotplayboybabes.com (7 seconds ago.)Spirtualguidance.space (9 seconds ago.)Danielispregnant.com (9 seconds ago.)Turizmpersoneltedarik.com (10 seconds ago.)Showbizdaily.ru (12 seconds ago.)Cookiesltd.com (14 seconds ago.)Dataops.co (16 seconds ago.)Brownwoodattorney.com (16 seconds ago.)Faithfilledbusiness.com (18 seconds ago.)Happyherobrands.com (18 seconds ago.)Comtechcan.com (19 seconds ago.)Ubchuulga.mn (20 seconds ago.)Badischerwein.com (20 seconds ago.)Videopromoter.com (20 seconds ago.)Vladgtk.ru (20 seconds ago.)Nse.org.ng (21 seconds ago.)401moneygang.com (24 seconds ago.)Generationalwealthplus.com (25 seconds ago.)Nfeedmx.com (25 seconds ago.)Bicepstest.com (27 seconds ago.)Crabapplepoodles.com (27 seconds ago.)Lbtgroup.com.ua (29 seconds ago.)Smallcars.pl (30 seconds ago.)Aoa3378.vip (32 seconds ago.)

Recently Searched Keywords

your browser does not support webgl (1 second ago.)trung tm (1 second ago.)complete streets (3 seconds ago.)technical marketing (3 seconds ago.).product-recommendation-price-column { display:flex !important (3 seconds ago.)gay sex videos (4 seconds ago.)網路商店 (7 seconds ago.)> contact us (8 seconds ago.)java培训 (8 seconds ago.)[続きを読む] (11 seconds ago.)battery management system course in india (11 seconds ago.)квітень 2021 (12 seconds ago.)c40f22 body sidebar-wrapper-style2 (12 seconds ago.)2px 2px rgba190 (13 seconds ago.)kesintisiz heyecanlarıyla bulutların üzerinde sevişen escort pelin (15 seconds ago.)air freight tracking (16 seconds ago.)type virtuallocation (18 seconds ago.)leben mit (19 seconds ago.)galaxy note 8 (22 seconds ago.)positionrelative z-index1 (23 seconds ago.)estate markets (24 seconds ago.)your browser does not support webgl (26 seconds ago.)ph perfect (26 seconds ago.)8px rgba50 (29 seconds ago.)trng th (32 seconds ago.)austrac (33 seconds ago.)2020年12月7日 (34 seconds ago.)tooltip1591882366--tpaarrowright0width7pxheight12px (34 seconds ago.)svg template-collectionnotproducts (35 seconds ago.)amp blog (35 seconds ago.)