Tomshardware.co.uk  |  Tom's Hardware : Hardware News, Tests and Reviews
High trust score  | 
Tom's Hardware is the Internet's premiere resource for hardware news and reviews

Tomshardware.co.uk Website Information

Tomshardware.co.uk has a High trust score, a Statvoo Rank of B, an Alexa Rank of 2,710, a Majestic Rank of 15,437, a Domain Authority of 54% and is not listed in DMOZ.

Tomshardware.co.uk is hosted by Amazon.com, Inc. in Oregon, Portland, United States, 97086.
Tomshardware.co.uk has an IP Address of 54.187.115.34 and a hostname of ec2-54-187-115-34.us-west-2.compute.amazonaws.

The domain tomshardware.co.uk was registered 1 decade 9 years 6 months ago by , it was last modified 5 years 5 months 1 week ago and currently is set to expire 201 decades 8 years 11 months ago.


Whois information for tomshardware.co.uk

Full Whois Lookup for Tomshardware.co.uk Whois Lookup

Domain name:
tomshardware.co.uk

Registrant:
Tom's Guides Publishing AG

Registrant type:
Unknown

Registrant's address:
Feringastrasse 4
Unterfoehring
85774
Germany

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registrar:
Gandi [Tag = GANDI]
URL: http://www.gandi.net

Relevant dates:
Registered on: 03-Mar-2000
Expiry date: 03-Mar-2018
Last updated: 01-Mar-2017

Registration status:
Registered until expiry date.

Name servers:
ns-1285.awsdns-32.org
ns-1602.awsdns-08.co.uk 205.251.198.66
ns-171.awsdns-21.com
ns-933.awsdns-52.net

WHOIS lookup made at 19:05:44 14-Sep-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Tomshardware.co.uk?

Tomshardware.co.uk Web Server Information

Hosted IP Address:54.187.115.34
Hosted Hostname:ec2-54-187-115-34.us-west-2.compute.amazonaws
Service Provider:Amazon.com, Inc.
Hosted Country:United StatesUS
Location Latitude:45.5234
Location Longitude:-122.676
Webserver Software:Not Applicable

HTTP Header Analysis for Tomshardware.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Accept-Ranges: bytes
Age: 0
Content-Type: text/html; charset=UTF-8
Date: Mon, 08 Jun 2015 23:58:17 GMT
Server: nginx
Vary: Accept-Encoding
Via: 1.1 varnish
X-Served-By: bom-aws-prod-varnish-1875df10
X-Varnish: 400977578
X-VARNISH-D: RpFpDp
Content-Length: 239485
Connection: keep-alive


Need to find out who hosts Tomshardware.co.uk?

Tomshardware.co.uk Free SEO Report

Website Inpage Analysis for Tomshardware.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Tomshardware.co.uk

mechanicalgraphicscmltopstorieslabel7before textindent 0displayinlineblock cmltopstories7checkedkeyboardright inherit cmltopstories5checkedcarouselmulticssctn cmltopstorieslabel16before4kwindowcarouselmulticssnavs carouselmulticssbullets labelforcmltopstories2elabelforcmltopstories1 opacity1ssd reviewleft10px right8carouselmulticssbullets labelforcmltopstories9f105 cmltopstories11checked carouselmulticssctnundefined rnlabelforcmltopstories3cmltopstorieslabel0before textindentcarouselmulticssctn cmltopstorieslabel9beforenewf105 cmltopstories4checked carouselmulticssctn10px cmltopstories1checked carouselmulticssctnlabelforcmltopstories7 opacity1windowtmntag tmntagadtagcarouselmulticssnavs carouselmulticssbullets labelforcmltopstories8my pccmltopstorieslabel110px cmltopstories8checkedcarouselmulticssbullets labelforcmltopstories13 opacity1topelse rn10px cmltopstories12checked carouselmulticssctnlabelforcmltopstories11 opacity1displayinlineblock cmltopstories1checked carouselmulticssctnaf261e carouselmulticsstopstories carouselmulticssbullet0f105 cmltopstories1checkedcarouselmulticssctn cmltopstorieslabel13carouselmulticssctn cmltopstorieslabel15cmltopstories10checkedcmltopstories0checked carouselmulticssnavsgtx 1060nowterms of usecmltopstorieslabel5before textindentcmltopstorieslabel15 display blocktabsprevnexttabhomeforum2noneelselabelforcmltopstories0 opacity1 boxshadow10px cmltopstories1checkedcarouselmulticssctn cmltopstorieslabel10beforecarouselmulticsswrapper left 200f105 cmltopstories10checked carouselmulticssctncmltopstories5checkedcmltopstorieslabel2before textindent 0f104 cmltopstories11checkedtabsnav tabsprevnexttabhomeforum4editiontabsprevnexttabhomenews2cmltopstorieslabel0 displaycmltopstorieslabel15before textindentcmltopstorieslabel7before textindentcryptocurrenciesonly0 cmltopstories0checked carouselmulticssnavs20tabsprevnexttabhomeforum1 labelbeforebackgroundcolor af261e cmltopstories5checkedf105 cmltopstories2checkedbackgroundcolor af261e cmltopstories9checkedcarouselmulticssbullet0eventmemorylabelforcmltopstories13 opacity1 boxshadowformrntttvarcarouselmulticssbullet12 displayinlineblockright 10px cmltopstories12checkedtabsnav tabsprevnexttabhomeforum4 labelbefore16gbhref valuelabelforcmltopstories10 opacity1cmltopstorieslabel5 display blockcmltopstories2checked carouselmulticssnavs carouselmulticssbulletsf104 cmltopstories10checkedbackgroundcolor af261e cmltopstories10checkeddisplayinlineblockaf261e cmltopstories5checkedf104 cmltopstories4checked carouselmulticssctntabhomeforum4checked tabsnav tabsprevnexttabhomeforum4dailyfunction event rnwidthlabelforcmltopstories0carouselmulticssctn cmltopstorieslabel5before textindentcarouselmulticsstopstories carouselmulticssbullet6f105 cmltopstories5checkedbackgroundcolorcan2labelbefore content nextf105 cmltopstories3checked carouselmulticssctnlabelforcmltopstories9 opacity1 boxshadowgaming laptopcarouselmulticssctn cmltopstorieslabel5f105 cmltopstories6checked carouselmulticssctncarouselmulticssctn cmltopstorieslabel12 displaygraphics card pricescmltopstorieslabel12if windowtmntag windowtmntagcmdf104 cmltopstories13checkedtabhomeforum4checked tabsnavcmltopstories1checked carouselmulticssnavscarouselmulticssctn cmltopstorieslabel2cmltopstorieslabel7content f105 cmltopstories11checkedcmltopstorieslabel7beforecarouselmulticssctn cmltopstorieslabel0elemlabelforcmltopstories5 opacity1carouselmulticssctn cmltopstorieslabel2before textindent13cmltopstorieslabel10 display blockcmltopstories14checkedcmltopstories6checked carouselmulticssnavsbackgroundcolor989898deals getcarouselmulticssbullets labelforcmltopstories6 opacity1labelforcmltopstories2 opacity1 boxshadowaf261e cmltopstories9checked carouselmulticssctnif windowtmntagattrcarouselmulticsstopstories carouselmulticssbullet6 displayinlineblockinherit cmltopstories7checked carouselmulticssctncmltopstorieslabel9before textindent 0carouselmulticssctn cmltopstorieslabel11before textindentsubscribeddisplayinlineblock cmltopstories1checkedcmltopstories11checked carouselmulticssnavs carouselmulticssbulletscmltopstorieslabel4before textindentcontent f105 cmltopstories3checkedcmltopstorieslabel10lookinherit cmltopstories6checked carouselmulticssctnaf261e cmltopstories9checked0tabhomenews1checked tabsnav tabsprevnexttabhomenews1labelforcmltopstories6cmltopstorieslabel16before textindent 0rn gtmdatalayerpusheventtabhomenews1checked tabsnavcontent f104cmltopstories8checked carouselmulticssctn carouselmulticsswrapperproductionf104 cmltopstories3checked carouselmulticssctnf105 cmltopstories1checked carouselmulticssctnbackgroundcolor af261e carouselmulticsstopstoriesifwithoutgtx 1050f105 cmltopstories4checkedinherit cmltopstories11checked carouselmulticssctndaily deal savetabsnav tabsprevnexttabhomeforum1 labelbeforetabhomeforum3checkedtabhomenews3checkedaf261e cmltopstories3checked carouselmulticssctnaf261e cmltopstories2checked carouselmulticssctninherit cmltopstories3checkedcarouselmulticssctn cmltopstorieslabel15before textindentcarouselmulticssctn cmltopstorieslabel13before textindentbackgroundcolor af261ecmltopstories2checked carouselmulticssnavscarouselmulticsswrapper left 150carouselmulticsswrapper left 50rncarouselmulticssctn cmltopstorieslabel3function eventlabelforcmltopstories12 opacity1cmltopstories1checked carouselmulticssctn carouselmulticsswrappercarouselmulticssnavs carouselmulticssbullets labelforcmltopstories4af261e carouselmulticsstopstories carouselmulticssbullet12tabsprevnexttabhomeforum4name href valuetypecontent f104 cmltopstories5checkedcarouselmulticssctn cmltopstorieslabel4beforecmltopstorieslabel1 displayclasscmltopstories11checked carouselmulticssctncmltopstorieslabel1before textindentinherit cmltopstories14checked carouselmulticssctntabsnav tabsprevnexttabhomeforum2youright 10px cmltopstories0checkeddisplay blockcontent f104 cmltopstories11checkedcmltopstorieslabel5tabsprevnexttabhomenews1 labelbeforetabsnav tabsprevnexttabhomenews2tabhomeforum3checked tabsnavcmltopstorieslabel15before textindent 0none backgroundcoloraf261e carouselmulticsstopstories carouselmulticssbullet6backgroundcolor af261e cmltopstories11checkednotcmltopstories0checkedinherit cmltopstories11checkedf105 cmltopstories10checkedcmltopstories5checked carouselmulticssnavscontent f104 cmltopstories7checkedtruecontent f105 cmltopstories6checkedcmltopstories8checked carouselmulticssnavscarouselmulticssctn cmltopstorieslabel6before0 content10px cmltopstories8checked carouselmulticssctntabhomeforum2checked tabsnavtechgraphics cardsclass valuenvidiaopacity1 boxshadow nonebackgroundcolor af261e cmltopstories12checkedcarouselmulticssctn cmltopstorieslabel11 display00bbblock left10pxcmltopstorieslabel4cmltopstorieslabel7 display24cmltopstorieslabel1before textindent 0displayinlineblock cmltopstories13checkednvidia geforceasrockcmltopstorieslabel14right 10px039overwatch039carouselmulticssctn cmltopstorieslabel7 displayopacity1formcontentboxshadow nonelabelforcmltopstories14 opacity1 boxshadowcarouselmulticssnavs carouselmulticssbullets labelforcmltopstories11carouselmulticssctn cmltopstorieslabel6before textindent0 cmltopstories0checkedcmltopstorieslabel1beforecmltopstories5checked carouselmulticssctn carouselmulticsswrapperge63vrcmltopstorieslabel0before textindent 0right inherit cmltopstories6checkedtom039smotherboardsmargintopcarouselmulticssctn cmltopstorieslabel2 displaytabsprevnexttabhomenews3carouselmulticsstopstories carouselmulticssbullet12 displayinlineblocklaptopcarouselmulticsstopstories carouselmulticssbullet12cmltopstorieslabel7 display blockaf261e cmltopstories8checked carouselmulticssctn10px cmltopstories6checkedcustomonyxcarouselmulticsswrapper left 16666666666667labelforcmltopstories1 opacity1 boxshadowif windowtmntag tmntagadtagmarginleft3pxdisplayinlineblockfloatright28buylabelforcmltopstories8cmltopstories6checkedcmltopstorieslabel13before textindentsoftwaretabhomenews1checkedtabhomenews4checked tabsnavcmltopstorieslabel13beforecarouselmulticssbullets labelforcmltopstories11windowtmntag windowtmntagcmdcarouselmulticssbullets labelforcmltopstories11 opacity1left 505cmltopstories8checked carouselmulticssctncmltopstorieslabel2 display blockcmltopstorieslabel12 display blockcmltopstorieslabel12 displaycmltopstorieslabel13 display blockcmltopstorieslabel2before10px cmltopstories3checkedcardinherit cmltopstories5checkedcmltopstories7checked carouselmulticssnavsf104 cmltopstories9checked carouselmulticssctncarouselmulticssbullets labelforcmltopstories1 opacity1labelforcmltopstories7 opacity1 boxshadowcarouselmulticsswrapper left 400monitoraf261e cmltopstories6checked carouselmulticssctncarouselmulticssctn cmltopstorieslabel8labelforcmltopstories4 opacity129carouselmulticssctn cmltopstorieslabel16before textindentcmltopstories1checked carouselmulticssctnlabelforcmltopstories9content f104 cmltopstories9checkedcmltopstorieslabel8 display blockbackgroundcolor af261e cmltopstories0checkedright inherit cmltopstories13checkedcmltopstorieslabel8labelforcmltopstories8 opacity1core26labelforcmltopstories6 opacity1 boxshadowcontent 00abcarouselmulticssctn cmltopstorieslabel12beforecarouselmulticssctn cmltopstorieslabel13 displaycarouselmulticsstopstories carouselmulticssitemctnblackcmltopstories14checked carouselmulticssnavs0 content f104af261e cmltopstories2checkedcarouselmulticssbullet0 displayinlineblock cmltopstories1checkedcarouselmulticssctn cmltopstorieslabel15beforeinherit cmltopstories2checked carouselmulticssctncarouselmulticssctn cmltopstorieslabel16 display17cpuscmltopstories6checked carouselmulticssnavs carouselmulticssbulletscarouselmulticssbullet12 displayinlineblock cmltopstories13checkedright 10px cmltopstories8checkedcmltopstorieslabel16cmltopstories13checkedprivacylabelforcmltopstories14geforceinherit cmltopstories6checkedwindowtmntagcmd tmntagcmdpushfunctioncarouselmulticsswrapper left 100cmltopstorieslabel11before textindentservicelistcarouselmulticssctn cmltopstorieslabel8before textindent32cmltopstories2checked carouselmulticssctn carouselmulticsswrappercmltopstorieslabel12before textindentcmltopstorieslabel16 display block10px cmltopstories10checkedgtmdatalayer undefinedlabelforcmltopstories7f104 cmltopstories14checked carouselmulticssctncmltopstories13checked carouselmulticssctn carouselmulticsswrappercmltopstorieslabel8beforebackgroundcolor af261e cmltopstories3checkedcarouselmulticssbullets labelforcmltopstories9 opacity1labelbefore contentdocumentcreateelementdivdevicecmltopstories10checked carouselmulticssnavs carouselmulticssbulletsgigabytecarouselmulticssbullets labelforcmltopstories5labelforcmltopstories6 opacity1leftinheritcmltopstories4checked carouselmulticssctn carouselmulticsswrapperinherit cmltopstories2checkedcmltopstorieslabel11before textindent 0false ifcarouselmulticssbullets labelforcmltopstories8toptextgeforce gtxownssdlabel colorfffcmltopstories13checked carouselmulticssnavstabsnav tabsprevnexttabhomenews1event rnfontsizecmltopstories4checked carouselmulticssnavsnextcmltopstories12checked carouselmulticssctnf104 cmltopstories2checked carouselmulticssctnundefinedcmltopstorieslabel6beforeright inherit cmltopstories1checkedgroupcmltopstorieslabel2right 10px cmltopstories2checkedcmltopstories9checked carouselmulticssctnrn rncmltopstories12checked carouselmulticssnavs carouselmulticssbulletscmltopstories10checked carouselmulticssnavsrn rn rnshouldf105 cmltopstories8checked carouselmulticssctnjsf104 cmltopstories12checked carouselmulticssctndisplayinlineblock cmltopstories13checked carouselmulticssctn10px cmltopstories5checkedgpucontent f105 cmltopstories4checkedcmltopstories12checkedinherit cmltopstories7checkedcarouselmulticssbullets labelforcmltopstories7 opacity1labelforcmltopstories2 opacity1tabsprevnexttabhomeforum4 labelbeforeecpopupmodalcontentcmltopstorieslabel6carouselmulticssctn cmltopstorieslabel3beforecmltopstories10checked carouselmulticssctn carouselmulticsswrapperaf261e cmltopstories4checked carouselmulticssctnlabelforcmltopstories11labelforcmltopstories14 opacity1colorfff backgroundcolor989898vstabhomeforum1checkedmakescarouselmulticssctn cmltopstorieslabel1carouselmulticsstopstories carouselmulticsswrapper widthcarouselmulticssctn cmltopstorieslabel4 displaycarouselmulticssnavs carouselmulticssbullets labelforcmltopstories6cmltopstorieslabel11carouselmulticssctn cmltopstorieslabel8 displaycmltopstories11checked carouselmulticssnavsf104 cmltopstories14checkedcmltopstories12checked carouselmulticssctn carouselmulticsswrapper1carouselmulticssbullets labelforcmltopstories1cmltopstories7checkedcmltopstories13checked carouselmulticssnavs carouselmulticssbulletsright 10px cmltopstories4checkedcmltopstorieslabel3 display blockcarouselmulticsstopstories carouselmulticssbullet0storageright 10px cmltopstories13checkedcarouselmulticssnavs carouselmulticssbullets labelforcmltopstories3cmltopstories14checked carouselmulticssctnperformanceleft 0f105 cmltopstories7checkedx299helpvaluecmltopstories9checkedcomingaf261e cmltopstories14checkedlabelforcmltopstories5maxwidthinherit cmltopstories12checked10px cmltopstories13checked carouselmulticssctnname classleftinherit right 10pxgtxgoodbrandcoloraf261e carouselmulticsstopstoriescontent f105carouselmulticssbullets labelforcmltopstories2content f104 cmltopstories14checkedraidercarouselmulticssnavs carouselmulticssbullets labelforcmltopstories9af261e cmltopstories8checkedoutleft 300questiongtmdatalayer typeof gtmdatalayercmltopstorieslabel6before textindentright inherit cmltopstories9checkedcmltopstorieslabel11 displayleftnotebookscmltopstories7checked carouselmulticssnavs carouselmulticssbulletslabelforcmltopstories11 opacity1 boxshadowcontent f105 cmltopstories12checkedf105paddingasrock fatal1tytabhomeforum4checkedcmltopstorieslabel5beforenamewindowtmntagcmd tmntagcmdpushfunction iftabhomeforum2checkedampaf261e cmltopstories12checkedcarouselmulticsswrapper left 0left 66666666666667af261e cmltopstories11checked carouselmulticssctnlabelbeforecmltopstorieslabel15upprices10px cmltopstories5checked carouselmulticssctn25 cryptocurrenciescarouselmulticssctn cmltopstorieslabel14before textindent15pxseagatecarouselmulticssbullets labelforcmltopstories8 opacity112labelforcmltopstories5 opacity1 boxshadowbackgroundcolor af261e cmltopstories8checkedequifaxcmltopstories9checked carouselmulticssctn carouselmulticsswrappercmltopstorieslabel3next 00bbcarouselmulticssctn cmltopstorieslabel16searchcmltopstories6checked carouselmulticssctn carouselmulticsswrappertextindentboxshadow none backgroundcolorcarouselmulticssbullets labelforcmltopstories13carouselmulticssctn cmltopstorieslabel11carouselmulticssbullets labelforcmltopstories14 opacity1f104 cmltopstories8checkedprocmltopstories3checked carouselmulticssnavscmltopstorieslabel0beforeleft 400catchcarouselmulticssctn cmltopstorieslabel6 displayf104 cmltopstories6checkedecpopupmodalge63vr raiderlabelforcmltopstories12 opacity1 boxshadowcarouselmulticsswrapper left 13333333333333cmltopstorieslabel6 display blocktmntagcmdpushfunction if windowtmntagcarouselmulticssctn cmltopstorieslabel10before textindentheightright inherit cmltopstories7checkedpopupusecmltopstories0checked carouselmulticssctnf105 cmltopstories13checked carouselmulticssctnasusneedlabelforcmltopstories410px cmltopstories11checked carouselmulticssctncontent f105 cmltopstories10checkedcarouselmulticssctn cmltopstorieslabel14gtx 1050 ticmltopstorieslabel12before25cmltopstories3checked carouselmulticssnavs carouselmulticssbulletscontent next 00bbf104 media screenrntttvaraf261e cmltopstories4checkedallcarouselmulticsswrapperreviewgtmdatalayercarouselmulticssctn cmltopstorieslabel15 displayf105 cmltopstories6checkedcarouselmulticssnavs1510px cmltopstories0checked carouselmulticssctncarouselmulticsstopstories carouselmulticssitemctn widthcarouselmulticssctn cmltopstorieslabel7before textindentcmltopstorieslabel6 displaygtmdatalayerpusheventcmltopstories0checked carouselmulticssnavs carouselmulticssbulletslabelforcmltopstories13 opacity1newdivmsicmltopstorieslabel8before textindent 0carouselmulticssbullet6 displayinlineblocksepnvidia geforce gtxattr namern ifinherit cmltopstories8checked carouselmulticssctnnone backgroundcolor af261elabelforcmltopstories10carouselmulticssctn cmltopstorieslabel11beforef105 cmltopstories9checkedtabsnav tabsprevnexttabhomenews1 labelbeforef104 cmltopstories7checked carouselmulticssctnrnttvarcmltopstories7checked carouselmulticssctncarouselmulticsswrapper left 300right inherit cmltopstories3checkedbackgroundcolor af261e cmltopstories14checkedcmltopstorieslabel9before textindentblock left10px rightright inherit cmltopstories10checkedtabsnav tabsprevnexttabhomeforum1content f104 cmltopstories13checkedcmltopstorieslabel16 displaybutgtx 1060 graphicscmltopstories0checked carouselmulticssctn carouselmulticsswrappercarouselmulticssnavs carouselmulticssbullets labelforcmltopstories10carouselmulticssctn cmltopstorieslabel0beforeamdwindowtmntagcmdaf261eupgradecard pricesright 10px cmltopstories10checkedcmltopstorieslabel10 displaytmntagcmdpushfunctionlabelforcmltopstories0 opacity110px cmltopstories13checked23af261e cmltopstories11checkedf105 cmltopstories8checkedtabsnav tabsprevnexttabhomenews4 labelbeforecarouselmulticssbullets labelforcmltopstories10 opacity1displayblockcmltopstories9checked carouselmulticssnavs carouselmulticssbulletsdisplay block leftinheritminwidthlabelforcmltopstories10 opacity1 boxshadowcmltopstorieslabel9rnttttttdaily dealcmltopstorieslabel13carouselmulticssnavs carouselmulticssbullets labelforcmltopstories7f105 cmltopstories9checked carouselmulticssctnscreen and minwidthlabelforcmltopstories2articlescarouselmulticssbullets labelforcmltopstories14inherit cmltopstories12checked carouselmulticssctncarouselmulticsstopstorieswindowtmntag windowtmntagcmd tmntagcmdpushfunctionlabelforcmltopstories13carouselmulticssbullet0 displayinlineblockf104 medianocmltopstorieslabel14beforecarouselmulticssbullets labelforcmltopstories12cmltopstories4checked carouselmulticssctn1050 ti0 content f105inherit cmltopstories4checkedf104 cmltopstories2checkedtabsprevnexttabhomeforum1carouselmulticssctn cmltopstorieslabel14beforeleft10px right inheritleft 0 cmltopstories0checkedf105 cmltopstories11checkedengbcmltopstorieslabel2 displaycmltopstorieslabel14before textindent 0displayf104 cmltopstories3checkedcarouselmulticssbullet12cmltopstories2checkedcarouselmulticssbullets labelforcmltopstories0 opacity1cmltopstories5checked carouselmulticssctncenterinherit cmltopstories13checked carouselmulticssctncarouselmulticssnavs carouselmulticssbulletsright 10px cmltopstories9checkedtextindent 0backgroundcolor af261e cmltopstories4checkedtabsprevnexttabhomeforum3inherit cmltopstories4checked carouselmulticssctncmltopstorieslabel14 displayi9cmltopstorieslabel9 display blockcmltopstorieslabel9 displaymatchtextindent 0 content1121carouselmulticssctn cmltopstorieslabel4before textindentright 10px cmltopstories7checkedcmltopstories7checked carouselmulticssctn carouselmulticsswrappercmltopstorieslabel4 displaytypeofbackgroundcolor af261e cmltopstories2checkedf105 cmltopstories5checked carouselmulticssctncarouselmulticssbullet6 displayinlineblock cmltopstories7checkedcarouselmulticssctn cmltopstorieslabel14 displayprofessionalcmltopstories14checked carouselmulticssctn carouselmulticsswrappertabhomenews2checkedcontent 00ab previouscore i9leftinherit right10px cmltopstories6checked carouselmulticssctncarouselmulticssbullets labelforcmltopstories6right inherit cmltopstories4checkedpolicyinherit cmltopstories14checkedcontent f104 mediacarouselmulticssctn cmltopstorieslabel4left 23333333333333cmltopstorieslabel2before textindentf105 cmltopstories12checkedlabelforcmltopstories8 opacity1 boxshadowcmltopstories1checked carouselmulticssnavs carouselmulticssbulletstabsnav tabsprevnexttabhomeforum3carouselmulticsswrapper leftcmltopstories11checked carouselmulticssctn carouselmulticsswrappercarouselmulticssctn cmltopstorieslabel7tabsprevnexttabhomenews4inherit cmltopstories1checked10px cmltopstories7checked carouselmulticssctn27name hrefcmltopstorieslabel9beforesamsungcarouselmulticssbullets labelforcmltopstories0carouselmulticssctn cmltopstorieslabel5 displayf104 cmltopstories8checked carouselmulticssctncarouselmulticssctn cmltopstorieslabel2beforecmltopstorieslabel15beforecmltopstories1checkedmonitor reviewreview sepdocumentcreateelementspancmltopstories12checked carouselmulticssnavspsubuttoncarouselmulticssnavs carouselmulticssbullets labelforcmltopstories12hardwarecontent f105 cmltopstories13checkedlabeltmntagadtagcarouselmulticssctninherit cmltopstories3checked carouselmulticssctnlabelforcmltopstories9 opacity1media screenaf261e cmltopstories0checked carouselmulticssctnsitecarouselmulticssbullets labelforcmltopstories4 opacity1cmltopstorieslabel3before textindentlabelforcmltopstories12vroc9left 200cmltopstorieslabel5 displaycarouselmulticssctn cmltopstorieslabel0 displayf104 cmltopstories5checkedlinelabelforcmltopstories3 opacity1 boxshadowcmltopstorieslabel6before textindent 0af261e cmltopstories10checkedaf261e cmltopstories0checkedhreff104boxshadowleft 100idgamingf104 cmltopstories9checked00ab previousopacity1 boxshadowintelcontent nextcontent f104 cmltopstories10checkedinherit cmltopstories9checked carouselmulticssctngraphics cardcatch ef104 cmltopstories12checked10px cmltopstories3checked carouselmulticssctnleft10pxcontent f104 cmltopstories12checkedpreviousdeals savecmltopstorieslabel4 display blocklabelbefore opacity5cmltopstories10checked carouselmulticssctn650wlabel colorfff backgroundcolor989898falsecmltopstories8checked carouselmulticssnavs carouselmulticssbulletsright 10px cmltopstories5checkedcmltopstorieslabel16before textindentcmltopstorieslabel3 displayundefined varcarouselmulticssnavs carouselmulticssbullets labelforcmltopstories13carouselmulticssctn cmltopstorieslabel3before textindentcontent f104 cmltopstories8checkedaf261e cmltopstories10checked carouselmulticssctncarouselmulticssitemctnf104 cmltopstories10checked carouselmulticssctnf104 cmltopstories6checked carouselmulticssctncmltopstorieslabel0carouselmulticssctn cmltopstorieslabel10 displaycmltopstories6checked carouselmulticssctnusopacity5carouselmulticssctn cmltopstorieslabel9before textindentf105 cmltopstories3checkedcmltopstorieslabel0 display blocktabsnav tabsprevnexttabhomenews4cmltopstorieslabel10before textindent 0dealscolorfffleft 13333333333333onyx 650wplatformcarouselmulticssbullet6hackunveilsrgbadvice10pxcarouselmulticssnavs carouselmulticssbullets labelforcmltopstories5carouselmulticssctn cmltopstorieslabel12carouselmulticssnavs carouselmulticssbullets labelforcmltopstories14gtmdatalayer undefined rnf104 cmltopstories11checked carouselmulticssctnmarginright3pxdisplayinlineblockfloatleft10px cmltopstories4checkedfalse rncmltopstorieslabel5before textindent 0inheritdealdisplayblock cmltopstories0checked carouselmulticssctncmltopstorieslabel14 display blockcontent f104 cmltopstories3checkedaf261e cmltopstories5checked carouselmulticssctn00abcarouselmulticsstopstories carouselmulticsswrappercarouselmulticssnavs carouselmulticssbullets labelforcmltopstories0inherit cmltopstories10checkedblock leftinherit rightreturnidctwidgetright 10px cmltopstories6checkedright inherit cmltopstories2checkedcmltopstorieslabel3beforetabhomenews4checkedcarouselmulticssctn carouselmulticsswrapper left10px cmltopstories2checkedcmltopstories3checked carouselmulticssctn carouselmulticsswrapper10px cmltopstories4checked carouselmulticssctncmltopstories5checked carouselmulticssnavs carouselmulticssbulletscmltopstorieslabel4before textindent 0carouselmulticsswrapper width3mediacarouselmulticssbullets labelforcmltopstories12 opacity1cmltopstorieslabel11beforecontent f105 cmltopstories7checkedinherit cmltopstories13checkedcarouselmulticssbullets labelforcmltopstories4inherit cmltopstories9checkeddisplayblock cmltopstories0checkedgtmdatalayer typeofcarouselmulticssctn cmltopstorieslabel0before textindenttabhomeforum1checked tabsnav tabsprevnexttabhomeforum1morecmltopstories14checked carouselmulticssnavs carouselmulticssbullets14colorcarouselmulticssitemctn widthcontent f104 cmltopstories2checkedcarouselmulticssctn cmltopstorieslabel3 displayurlcarouselmulticssctn cmltopstorieslabel9 displaycontent f105 cmltopstories8checked10px cmltopstories10checked carouselmulticssctnf104 cmltopstories4checkedfunctioncarouselmulticssbullets labelforcmltopstories3 opacity1carouselmulticssbullets labelforcmltopstories10content f105 cmltopstories1checkedcarouselmulticssctn cmltopstorieslabel13beforecontent f105 cmltopstories9checkedcmltopstories8checked10px cmltopstories7checked31right inherittabhomenews2checked tabsnavcarouselmulticssctn cmltopstorieslabel6acerscookietabhomenews4checked tabsnav tabsprevnexttabhomenews4nytro 14116any10px cmltopstories9checked10px cmltopstories12checkedlatestcmltopstories9checked carouselmulticssnavsblock10right 10px cmltopstories1checkedleft 33333333333333windowtmntaggamesavailablecmltopstories13checked carouselmulticssctncontent f105 cmltopstories5checkedoctobercmltopstories4checkedcarouselmulticsswrapper left 23333333333333trackf104 cmltopstories5checked carouselmulticssctncmltopstorieslabel8 displaycmltopstorieslabel16beforecarouselmulticssctn carouselmulticsswrappercmltopstorieslabel8before textindentlaptopsinherit cmltopstories10checked carouselmulticssctncmltopstorieslabel10before10px cmltopstories0checkedf105 cmltopstories13checkedaf261e cmltopstories12checked carouselmulticssctncarouselmulticssbullets labelforcmltopstories3left 1501 rncontent f104 cmltopstories4checkedf104 cmltopstories13checked carouselmulticssctnpctabsnav tabsprevnexttabhomenews3carouselmulticssctn cmltopstorieslabel1beforetmntagcmdpushfunction ifcmltopstorieslabel13 displaycarouselmulticssctn cmltopstorieslabel9buildcarouselmulticssbullets labelforcmltopstories2 opacity1nytrotypeof gtmdatalayerlabelforcmltopstories4 opacity1 boxshadowrn varbootclose22labelforcmltopstories3 opacity1cmltopstorieslabel15 displaydisplayinlineblock cmltopstories7checked carouselmulticssctncmltopstorieslabel1 display blockblock leftinherit6haverightinherit cmltopstories1checked carouselmulticssctncarouselmulticssnavs carouselmulticssbullets labelforcmltopstories1inherit cmltopstories8checkedf105 cmltopstories7checked carouselmulticssctncmltopstorieslabel13before textindent 0name class value1060 graphics10px cmltopstories9checked carouselmulticssctnyourmarketkeycapcarouselmulticssctn cmltopstorieslabel8beforetitom039s hardwarecmltopstories3checkedtabsprevnexttabhomenews4 labelbefore4tabhomeforum1checked tabsnavcontent f104 cmltopstories6checkedcarouselmulticsswrapper left 33333333333333carouselmulticssbullets labelforcmltopstories5 opacity1cmltopstories11checkedcardsright 10px cmltopstories3checkedf105 cmltopstories12checked carouselmulticssctncarouselmulticssctn cmltopstorieslabel12before textindentcarouselmulticssctn cmltopstorieslabel1 displayscreentabscontentright 10px cmltopstories11checkedcmltopstorieslabel4beforeright inherit cmltopstories8checked7tabhomenews3checked tabsnavoffaf261e cmltopstories14checked carouselmulticssctnecpopupmodalcontent toptext19af261e cmltopstories3checkedrntttttbackgroundcolor af261e cmltopstories6checkedtypeof gtmdatalayer undefinedhascarouselmulticssctn cmltopstorieslabel1before textindentgetaf261e cmltopstories6checkedcmltopstorieslabel11 display block18content f105 cmltopstories2checkedfalse if windowtmntagcmltopstories4checked carouselmulticssnavs carouselmulticssbulletscarouselmulticssctn cmltopstorieslabel10right inherit cmltopstories12checkedcmltopstorieslabel3before textindent 0demolabelbefore content 00abvartargetfanscmltopstorieslabel14before textindentpositiontabsnavcmltopstorieslabel10before textindentlabelforcmltopstories1carouselmulticssbullets labelforcmltopstories7carouselmulticssctn cmltopstorieslabel5beforecarouselmulticssctn cmltopstorieslabel7beforecarouselmulticssbulletsinherit cmltopstories5checked carouselmulticssctncarouselmulticsswrapper left 6666666666666710px cmltopstories11checkedright inherit cmltopstories14checkedleft 1666666666666730rnttcaseright inherit cmltopstories11checkeddisplay block left10pxcmltopstories3checked carouselmulticssctn10px cmltopstories2checked carouselmulticssctncarouselmulticsstopstories carouselmulticssbullet0 displayinlineblockmytermsdeal savecmltopstorieslabel12before textindent 0cpupopularcmltopstories2checked carouselmulticssctnfatal1tysaveactiongooglef104 cmltopstories7checkedtabsprevnexttabhomenews1f105 cmltopstories2checked carouselmulticssctn

Longtail Keyword Density for Tomshardware.co.uk

KeywordsOccurences
opacity1 box-shadow none75
none background-color af261e75
carousel-multi-css-ctn carousel-multi-css-wrapper left75
box-shadow none background-color75
left10px right inherit70
text-indent 0 content70
block left10px right70
display block left10px70
display block leftinherit70
block leftinherit right70
leftinherit right 10px70
text-indent -0 content70
-0 content f10570
0 content f10470
background-color af261e carousel-multi-css--top-stories34
carousel-multi-css-ctn cml-top-stories-label6before text-indent10
carousel-multi-css-ctn cml-top-stories-label8 display10
carousel-multi-css-ctn cml-top-stories-label6 display10
cml-top-stories-label6 display block10
cml-top-stories-label8 display block10
content f105 cml-top-stories1checked10
f105 cml-top-stories1checked carousel-multi-css-ctn10
cml-top-stories-label7 display block10
carousel-multi-css-ctn cml-top-stories-label7before text-indent10
carousel-multi-css-ctn cml-top-stories-label7 display10
carousel-multi-css-ctn cml-top-stories-label8before text-indent10
tmntagcmdpushfunction if windowtmntag9
windowtmntagcmd tmntagcmdpushfunction if9
windowtmntag windowtmntagcmd tmntagcmdpushfunction9
if windowtmntag windowtmntagcmd9
if windowtmntag tmntagadtag9
carousel-multi-css-ctn cml-top-stories-label5 display8
labelbefore content 00ab8
label colorfff background-color9898988
carousel-multi-css-ctn cml-top-stories-label3 display8
carousel-multi-css-ctn cml-top-stories-label9 display8
carousel-multi-css-ctn cml-top-stories-label5before text-indent8
cml-top-stories-label5 display block8
content next 00bb8
labelbefore content next8
content 00ab previous8
carousel-multi-css-ctn cml-top-stories-label10 display8
carousel-multi-css-ctn cml-top-stories-label4 display8
cml-top-stories-label3 display block8
carousel-multi-css-ctn cml-top-stories-label11before text-indent8
cml-top-stories-label10 display block8
carousel-multi-css-ctn cml-top-stories-label9before text-indent8
cml-top-stories-label9 display block8
carousel-multi-css-ctn cml-top-stories-label4before text-indent8
carousel-multi-css-ctn cml-top-stories-label10before text-indent8
cml-top-stories-label4 display block8
cml-top-stories-label11 display block8
carousel-multi-css-ctn cml-top-stories-label11 display8
carousel-multi-css-ctn cml-top-stories-label3before text-indent8
carousel-multi-css-ctn cml-top-stories-label2 display7
cml-top-stories-label2 display block7
carousel-multi-css-ctn cml-top-stories-label2before text-indent7
carousel-multi-css-ctn cml-top-stories-label12before text-indent7
cml-top-stories-label12 display block7
carousel-multi-css-ctn cml-top-stories-label12 display7
cml-top-stories-label1 display block6
carousel-multi-css-ctn cml-top-stories-label1 display6
cml-top-stories-label13 display block6
carousel-multi-css-ctn cml-top-stories-label13before text-indent6
carousel-multi-css-ctn cml-top-stories-label13 display6
carousel-multi-css-ctn cml-top-stories-label1before text-indent6
10px cml-top-stories7checked carousel-multi-css-ctn5
cml-top-stories-label8before text-indent -05
content f105 cml-top-stories7checked5
right 10px cml-top-stories7checked5
content f104 cml-top-stories7checked5
cml-top-stories-label5before text-indent 05
inherit cml-top-stories6checked carousel-multi-css-ctn5
f104 cml-top-stories7checked carousel-multi-css-ctn5
10px cml-top-stories6checked carousel-multi-css-ctn5
right 10px cml-top-stories5checked5
10px cml-top-stories5checked carousel-multi-css-ctn5
cml-top-stories-label6before text-indent -05
content f105 cml-top-stories5checked5
f104 cml-top-stories5checked carousel-multi-css-ctn5
content f104 cml-top-stories5checked5
f105 cml-top-stories4checked carousel-multi-css-ctn5
right inherit cml-top-stories4checked5
inherit cml-top-stories4checked carousel-multi-css-ctn5
cml-top-stories-label3before text-indent 05
f105 cml-top-stories5checked carousel-multi-css-ctn5
inherit cml-top-stories5checked carousel-multi-css-ctn5
content f105 cml-top-stories4checked5
cml-top-stories-label7before text-indent -05
content f105 cml-top-stories6checked5
f105 cml-top-stories6checked carousel-multi-css-ctn5
right 10px cml-top-stories6checked5
f105 cml-top-stories7checked carousel-multi-css-ctn5
cml-top-stories-label4before text-indent 05
content f104 cml-top-stories6checked5
f104 cml-top-stories6checked carousel-multi-css-ctn5
right inherit cml-top-stories6checked5
cml-top-stories-label7before text-indent 05
content f105 cml-top-stories12checked5
cml-top-stories-label13before text-indent -05
10px cml-top-stories12checked carousel-multi-css-ctn5
f105 cml-top-stories12checked carousel-multi-css-ctn5
right inherit cml-top-stories12checked5
content f104 cml-top-stories13checked5
inherit cml-top-stories12checked carousel-multi-css-ctn5
right 10px cml-top-stories12checked5
f104 cml-top-stories12checked carousel-multi-css-ctn5
content f105 cml-top-stories11checked5
cml-top-stories-label12before text-indent -05
10px cml-top-stories11checked carousel-multi-css-ctn5
f105 cml-top-stories11checked carousel-multi-css-ctn5
right inherit cml-top-stories11checked5
content f104 cml-top-stories12checked5
inherit cml-top-stories11checked carousel-multi-css-ctn5
f104 cml-top-stories13checked carousel-multi-css-ctn5
carousel-multi-css-ctn cml-top-stories-label14 display5
f104 cml-top-stories14checked carousel-multi-css-ctn5
content f104 cml-top-stories14checked5
inherit cml-top-stories13checked carousel-multi-css-ctn5
right inherit cml-top-stories14checked5
inherit cml-top-stories14checked carousel-multi-css-ctn5
daily deal save5
carousel-multi-css-wrapper left -166666666666675
right inherit cml-top-stories13checked5
f105 cml-top-stories13checked carousel-multi-css-ctn5
right 10px cml-top-stories13checked5
cml-top-stories-label14 display block5
10px cml-top-stories13checked carousel-multi-css-ctn5
carousel-multi-css-ctn cml-top-stories-label14before text-indent5
content f105 cml-top-stories13checked5
cml-top-stories-label14before text-indent -05
right 10px cml-top-stories11checked5
f104 cml-top-stories11checked carousel-multi-css-ctn5
inherit cml-top-stories8checked carousel-multi-css-ctn5
right inherit cml-top-stories8checked5
f105 cml-top-stories8checked carousel-multi-css-ctn5
10px cml-top-stories4checked carousel-multi-css-ctn5
content f104 cml-top-stories9checked5
right 10px cml-top-stories9checked5
f104 cml-top-stories9checked carousel-multi-css-ctn5
content f105 cml-top-stories8checked5
cml-top-stories-label9before text-indent -05
cml-top-stories-label6before text-indent 05
inherit cml-top-stories7checked carousel-multi-css-ctn5
content f104 cml-top-stories8checked5
f104 cml-top-stories8checked carousel-multi-css-ctn5
10px cml-top-stories8checked carousel-multi-css-ctn5
right 10px cml-top-stories8checked5
10px cml-top-stories9checked carousel-multi-css-ctn5
cml-top-stories-label10before text-indent -05
content f105 cml-top-stories10checked5
cml-top-stories-label11before text-indent -05
10px cml-top-stories10checked carousel-multi-css-ctn5
f105 cml-top-stories10checked carousel-multi-css-ctn5
right inherit cml-top-stories10checked5
content f104 cml-top-stories11checked5
inherit cml-top-stories10checked carousel-multi-css-ctn5
right 10px cml-top-stories10checked5
f104 cml-top-stories10checked carousel-multi-css-ctn5
f105 cml-top-stories9checked carousel-multi-css-ctn5
content f105 cml-top-stories9checked5
right inherit cml-top-stories9checked5
inherit cml-top-stories9checked carousel-multi-css-ctn5
content f104 cml-top-stories10checked5
cml-top-stories-label8before text-indent 05
right inherit cml-top-stories7checked5
right inherit cml-top-stories5checked5
cml-top-stories6checked carousel-multi-css-ctn carousel-multi-css-wrapper5
labelforcml-top-stories5 opacity1 box-shadow5
carousel-multi-css-bullets labelforcml-top-stories5 opacity15
cml-top-stories6checked carousel-multi-css-navs carousel-multi-css-bullets5
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories65
labelforcml-top-stories6 opacity1 box-shadow5
carousel-multi-css-bullets labelforcml-top-stories6 opacity15
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories55
cml-top-stories5checked carousel-multi-css-navs carousel-multi-css-bullets5
cml-top-stories4checked carousel-multi-css-navs carousel-multi-css-bullets5
cml-top-stories4checked carousel-multi-css-ctn carousel-multi-css-wrapper5
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories45
carousel-multi-css-bullets labelforcml-top-stories4 opacity15
cml-top-stories5checked carousel-multi-css-ctn carousel-multi-css-wrapper5
labelforcml-top-stories4 opacity1 box-shadow5
af261e carousel-multi-css--top-stories carousel-multi-css-bullet-65
carousel-multi-css--top-stories carousel-multi-css-bullet-6 displayinline-block5
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories85
cml-top-stories8checked carousel-multi-css-navs carousel-multi-css-bullets5
carousel-multi-css-bullets labelforcml-top-stories8 opacity15
labelforcml-top-stories8 opacity1 box-shadow5
cml-top-stories9checked carousel-multi-css-navs carousel-multi-css-bullets5
cml-top-stories9checked carousel-multi-css-ctn carousel-multi-css-wrapper5
cml-top-stories8checked carousel-multi-css-ctn carousel-multi-css-wrapper5
labelforcml-top-stories7 opacity1 box-shadow5
displayinline-block cml-top-stories7checked carousel-multi-css-ctn5
carousel-multi-css-bullet-6 displayinline-block cml-top-stories7checked5
cml-top-stories7checked carousel-multi-css-ctn carousel-multi-css-wrapper5
cml-top-stories7checked carousel-multi-css-navs carousel-multi-css-bullets5
carousel-multi-css-bullets labelforcml-top-stories7 opacity15
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories75
labelforcml-top-stories3 opacity1 box-shadow5
right 10px cml-top-stories4checked5
carousel-multi-css-bullets labelforcml-top-stories0 opacity15
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories05
cml-top-stories0checked carousel-multi-css-navs carousel-multi-css-bullets5
labelforcml-top-stories0 opacity1 box-shadow5
af261e carousel-multi-css--top-stories carousel-multi-css-bullet-05
carousel-multi-css-bullet-0 displayinline-block cml-top-stories1checked5
carousel-multi-css--top-stories carousel-multi-css-bullet-0 displayinline-block5
-0 cml-top-stories0checked carousel-multi-css-navs5
left -0 cml-top-stories0checked5
carousel-multi-css--top-stories carousel-multi-css-wrapper width5
false if windowtmntag5
carousel-multi-css--top-stories carousel-multi-css-item-ctn width5
displayblock cml-top-stories0checked carousel-multi-css-ctn5
carousel-multi-css-wrapper left -05
cml-top-stories0checked carousel-multi-css-ctn carousel-multi-css-wrapper5
displayinline-block cml-top-stories1checked carousel-multi-css-ctn5
cml-top-stories1checked carousel-multi-css-ctn carousel-multi-css-wrapper5
carousel-multi-css-bullets labelforcml-top-stories2 opacity15
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories25
labelforcml-top-stories2 opacity1 box-shadow5
cml-top-stories3checked carousel-multi-css-ctn carousel-multi-css-wrapper5
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories35
cml-top-stories3checked carousel-multi-css-navs carousel-multi-css-bullets5
cml-top-stories2checked carousel-multi-css-navs carousel-multi-css-bullets5
carousel-multi-css-wrapper left -2005
cml-top-stories1checked carousel-multi-css-navs carousel-multi-css-bullets5
carousel-multi-css-wrapper left -1005
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories15
carousel-multi-css-bullets labelforcml-top-stories1 opacity15
cml-top-stories2checked carousel-multi-css-ctn carousel-multi-css-wrapper5
labelforcml-top-stories1 opacity1 box-shadow5
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories95
carousel-multi-css-bullets labelforcml-top-stories3 opacity15
cml-top-stories-label0before text-indent 05
carousel-multi-css-ctn cml-top-stories-label0before text-indent5
content f104 cml-top-stories2checked5
f104 cml-top-stories2checked carousel-multi-css-ctn5
10px cml-top-stories2checked carousel-multi-css-ctn5
right 10px cml-top-stories2checked5
inherit cml-top-stories1checked carousel-multi-css-ctn5
right inherit cml-top-stories1checked5
10px cml-top-stories0checked carousel-multi-css-ctn5
right 10px cml-top-stories0checked5
right 10px cml-top-stories1checked5
10px cml-top-stories1checked carousel-multi-css-ctn5
cml-top-stories-label0 display block5
carousel-multi-css-ctn cml-top-stories-label0 display5
content f105 cml-top-stories2checked5
f105 cml-top-stories2checked carousel-multi-css-ctn5
content f104 cml-top-stories4checked5
f104 cml-top-stories4checked carousel-multi-css-ctn5
cml-top-stories-label2before text-indent 05
f105 cml-top-stories3checked carousel-multi-css-ctn5
right inherit cml-top-stories3checked5
inherit cml-top-stories3checked carousel-multi-css-ctn5
carousel-multi-css-bullets labelforcml-top-stories9 opacity15
content f105 cml-top-stories3checked5
cml-top-stories-label1before text-indent 05
inherit cml-top-stories2checked carousel-multi-css-ctn5
content f104 cml-top-stories3checked5
f104 cml-top-stories3checked carousel-multi-css-ctn5
10px cml-top-stories3checked carousel-multi-css-ctn5
right 10px cml-top-stories3checked5
labelforcml-top-stories14 opacity1 box-shadow5
right inherit cml-top-stories2checked5
cml-top-stories12checked carousel-multi-css-navs carousel-multi-css-bullets5
cml-top-stories12checked carousel-multi-css-ctn carousel-multi-css-wrapper5
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories125
cml-top-stories10checked carousel-multi-css-ctn carousel-multi-css-wrapper5
af261e carousel-multi-css--top-stories carousel-multi-css-bullet-125
labelforcml-top-stories12 opacity1 box-shadow5
labelforcml-top-stories11 opacity1 box-shadow5
carousel-multi-css-bullets labelforcml-top-stories11 opacity15
cml-top-stories11checked carousel-multi-css-ctn carousel-multi-css-wrapper5
labelforcml-top-stories9 opacity1 box-shadow5
carousel-multi-css-bullets labelforcml-top-stories10 opacity15
cml-top-stories11checked carousel-multi-css-navs carousel-multi-css-bullets5
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories115
carousel-multi-css--top-stories carousel-multi-css-bullet-12 displayinline-block5
carousel-multi-css-bullets labelforcml-top-stories12 opacity15
cml-top-stories14checked carousel-multi-css-ctn carousel-multi-css-wrapper5
cml-top-stories10checked carousel-multi-css-navs carousel-multi-css-bullets5
labelforcml-top-stories13 opacity1 box-shadow5
cml-top-stories14checked carousel-multi-css-navs carousel-multi-css-bullets5
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories145
carousel-multi-css-bullets labelforcml-top-stories14 opacity15
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories105
carousel-multi-css-navs carousel-multi-css-bullets labelforcml-top-stories135
carousel-multi-css-bullets labelforcml-top-stories13 opacity15
labelforcml-top-stories10 opacity1 box-shadow5
displayinline-block cml-top-stories13checked carousel-multi-css-ctn5
cml-top-stories13checked carousel-multi-css-ctn carousel-multi-css-wrapper5
carousel-multi-css-bullet-12 displayinline-block cml-top-stories13checked5
cml-top-stories13checked carousel-multi-css-navs carousel-multi-css-bullets5
af261e cml-top-stories14checked carousel-multi-css-ctn4
background-color af261e cml-top-stories14checked4
af261e cml-top-stories12checked carousel-multi-css-ctn4
carousel-multi-css-ctn cml-top-stories-label-1 display4
background-color af261e cml-top-stories12checked4
cml-top-stories-label15 display block4
carousel-multi-css-ctn cml-top-stories-label15before text-indent4
cml-top-stories-label15before text-indent -04
carousel-multi-css-wrapper left -333333333333334
carousel-multi-css-ctn cml-top-stories-label15 display4
carousel-multi-css-ctn cml-top-stories-label-1before text-indent4
cml-top-stories-label-1before text-indent 04
cml-top-stories-label-1 display block4
content f104 media4
screen and min-width4
f104 media screen4
graphics card prices4
nvidia geforce gtx4
background-color af261e cml-top-stories2checked4
af261e cml-top-stories2checked carousel-multi-css-ctn4
background-color af261e cml-top-stories8checked4
af261e cml-top-stories8checked carousel-multi-css-ctn4
af261e cml-top-stories6checked carousel-multi-css-ctn4
background-color af261e cml-top-stories6checked4
rn rn rn4
carousel-multi-css-ctn cml-top-stories-label16before text-indent3
cml-top-stories-label16 display block3
cml-top-stories-label16before text-indent -03
gtx 1060 graphics3
tab-home-news-1checked tabs-nav tabs-prev-nexttab-home-news-13
tabs-nav tabs-prev-nexttab-home-news-1 labelbefore3
gtx 1050 ti3
tab-home-forum-4checked tabs-nav tabs-prev-nexttab-home-forum-43
carousel-multi-css-ctn cml-top-stories-label16 display3
name href value3
terms of use3
function event rn3
typeof gtmdatalayer undefined3
gtmdatalayer typeof gtmdatalayer3
name class value3
gtmdatalayer undefined rn3
tab-home-news-4checked tabs-nav tabs-prev-nexttab-home-news-43
tabs-nav tabs-prev-nexttab-home-news-4 labelbefore3
tab-home-forum-1checked tabs-nav tabs-prev-nexttab-home-forum-13
tabs-nav tabs-prev-nexttab-home-forum-1 labelbefore3
tabs-nav tabs-prev-nexttab-home-forum-4 labelbefore3
cml-top-stories-label5before text-indent -03
carousel-multi-css-wrapper left -1503
background-color af261e cml-top-stories4checked3
carousel-multi-css-wrapper left -503
af261e cml-top-stories4checked carousel-multi-css-ctn3
background-color af261e cml-top-stories10checked3
carousel-multi-css-wrapper left -666666666666673
af261e cml-top-stories10checked carousel-multi-css-ctn3
cml-top-stories-label4before text-indent -03
cml-top-stories-label3before text-indent -03
carousel-multi-css-wrapper left -4003
cml-top-stories-label9before text-indent 03
cml-top-stories-label10before text-indent 03
carousel-multi-css-wrapper left -3003
cml-top-stories-label11before text-indent 03
background-color af261e cml-top-stories3checked3
af261e cml-top-stories3checked carousel-multi-css-ctn3
background-color af261e cml-top-stories0checked3
af261e cml-top-stories11checked carousel-multi-css-ctn3
af261e cml-top-stories0checked carousel-multi-css-ctn3
carousel-multi-css-ctn cml-top-stories-label-2 display3
carousel-multi-css-ctn cml-top-stories-label-2before text-indent3
cml-top-stories-label-2 display block3
background-color af261e cml-top-stories11checked3
af261e cml-top-stories9checked carousel-multi-css-ctn3
background-color af261e cml-top-stories5checked3
carousel-multi-css-wrapper left -133333333333333
af261e cml-top-stories5checked carousel-multi-css-ctn3
carousel-multi-css-wrapper left -233333333333333
background-color af261e cml-top-stories9checked3
cml-top-stories-label-2before text-indent 03
display block148
opacity1 box-shadow75
carousel-multi-css-navs carousel-multi-css-bullets75
box-shadow none75
none background-color75
background-color af261e75
carousel-multi-css-wrapper left75
carousel-multi-css-ctn carousel-multi-css-wrapper75
right 10px71
-0 content70
right inherit70
0 content70
leftinherit right70
content f10470
block leftinherit70
text-indent -070
text-indent 070
content f10570
block left10px70
left10px right70
af261e carousel-multi-css--top-stories34
cml-top-stories3checked carousel-multi-css-ctn25
cml-top-stories5checked carousel-multi-css-ctn25
cml-top-stories6checked carousel-multi-css-ctn25
cml-top-stories13checked carousel-multi-css-ctn25
cml-top-stories10checked carousel-multi-css-ctn25
cml-top-stories12checked carousel-multi-css-ctn25
cml-top-stories8checked carousel-multi-css-ctn25
cml-top-stories7checked carousel-multi-css-ctn25
cml-top-stories9checked carousel-multi-css-ctn25
cml-top-stories2checked carousel-multi-css-ctn25
cml-top-stories11checked carousel-multi-css-ctn25
cml-top-stories4checked carousel-multi-css-ctn25
cml-top-stories1checked carousel-multi-css-ctn25
if windowtmntag18
labelbefore content16
cml-top-stories14checked carousel-multi-css-ctn15
cml-top-stories0checked carousel-multi-css-ctn15
cml-top-stories-label8 display10
cml-top-stories-label7 display10
carousel-multi-css-ctn cml-top-stories-label610
review sep10
carousel-multi-css-ctn cml-top-stories-label8before10
carousel-multi-css-ctn cml-top-stories-label6before10
cml-top-stories-label6before text-indent10
carousel-multi-css-ctn cml-top-stories-label810
f105 cml-top-stories1checked10
cml-top-stories-label8before text-indent10
carousel-multi-css-ctn cml-top-stories-label7before10
cml-top-stories-label7before text-indent10
carousel-multi-css-ctn cml-top-stories-label710
cml-top-stories-label6 display10
rn rn9
rn if9
tom039s hardware9
windowtmntag tmntagadtag9
windowtmntag windowtmntagcmd9
tmntagcmdpushfunction if9
windowtmntagcmd tmntagcmdpushfunction9
carousel-multi-css-ctn cml-top-stories-label118
cml-top-stories-label10before text-indent8
carousel-multi-css-ctn cml-top-stories-label48
carousel-multi-css-ctn cml-top-stories-label11before8
cml-top-stories-label11 display8
cml-top-stories-label5before text-indent8
cml-top-stories-label5 display8
cml-top-stories-label11before text-indent8
carousel-multi-css-ctn cml-top-stories-label58
carousel-multi-css-ctn cml-top-stories-label10before8
carousel-multi-css-ctn cml-top-stories-label98
next 00bb8
content next8
carousel-multi-css-ctn cml-top-stories-label3before8
cml-top-stories-label3 display8
carousel-multi-css-ctn cml-top-stories-label38
cml-top-stories-label3before text-indent8
cml-top-stories-label4 display8
carousel-multi-css-ctn cml-top-stories-label9before8
cml-top-stories-label9before text-indent8
cml-top-stories-label9 display8
carousel-multi-css-ctn cml-top-stories-label4before8
colorfff background-color9898988
cml-top-stories-label4before text-indent8
content 00ab8
cml-top-stories-label10 display8
carousel-multi-css-ctn cml-top-stories-label108
carousel-multi-css-ctn cml-top-stories-label5before8
label colorfff8
00ab previous8
cml-top-stories-label2before text-indent7
carousel-multi-css-ctn cml-top-stories-label2before7
cml-top-stories-label2 display7
carousel-multi-css-ctn cml-top-stories-label27
carousel-multi-css-ctn cml-top-stories-label12before7
daily deal7
carousel-multi-css-ctn cml-top-stories-label127
cml-top-stories-label12before text-indent7
cml-top-stories-label12 display7
tab-home-forum-1checked tabs-nav6
carousel-multi-css-ctn cml-top-stories-label136
carousel-multi-css-ctn cml-top-stories-label13before6
cml-top-stories-label13before text-indent6
geforce gtx6
tab-home-news-1checked tabs-nav6
tab-home-news-4checked tabs-nav6
deals get6
tab-home-forum-4checked tabs-nav6
cml-top-stories-label13 display6
cml-top-stories-label1before text-indent6
cml-top-stories-label1 display6
carousel-multi-css-ctn cml-top-stories-label16
carousel-multi-css-ctn cml-top-stories-label1before6
media screen6
f104 cml-top-stories8checked5
inherit cml-top-stories7checked5
tab-home-news-3checked tabs-nav5
tabs-nav tabs-prev-nexttab-home-news-45
tab-home-news-2checked tabs-nav5
tabs-nav tabs-prev-nexttab-home-news-15
catch e5
gtx 10605
f105 cml-top-stories6checked5
f105 cml-top-stories7checked5
tabs-nav tabs-prev-nexttab-home-forum-45
inherit cml-top-stories6checked5
undefined var5
tabs-nav tabs-prev-nexttab-home-forum-15
rn var5
10px cml-top-stories7checked5
tab-home-forum-3checked tabs-nav5
tab-home-forum-2checked tabs-nav5
deal save5
left -166666666666675
cml-top-stories-label14before text-indent5
inherit cml-top-stories11checked5
f105 cml-top-stories11checked5
f104 cml-top-stories12checked5
10px cml-top-stories12checked5
f105 cml-top-stories12checked5
10px cml-top-stories9checked5
10px cml-top-stories11checked5
f105 cml-top-stories9checked5
inherit cml-top-stories9checked5
f104 cml-top-stories10checked5
f105 cml-top-stories10checked5
inherit cml-top-stories10checked5
f104 cml-top-stories11checked5
inherit cml-top-stories12checked5
f104 cml-top-stories13checked5
f105 cml-top-stories13checked5
f105 cml-top-stories8checked5
inherit cml-top-stories13checked5
f104 cml-top-stories14checked5
inherit cml-top-stories14checked5
10px cml-top-stories10checked5
carousel-multi-css-ctn cml-top-stories-label14before5
carousel-multi-css-ctn cml-top-stories-label145
f104 cml-top-stories9checked5
cml-top-stories-label14 display5
10px cml-top-stories13checked5
inherit cml-top-stories8checked5
10px cml-top-stories8checked5
f104 cml-top-stories7checked5
left -1005
displayinline-block cml-top-stories1checked5
carousel-multi-css-bullets labelforcml-top-stories55
labelforcml-top-stories5 opacity15
cml-top-stories1checked carousel-multi-css-navs5
carousel-multi-css--top-stories carousel-multi-css-bullet-05
left -2005
labelforcml-top-stories1 opacity15
carousel-multi-css-bullet-0 displayinline-block5
carousel-multi-css-bullets labelforcml-top-stories15
cml-top-stories6checked carousel-multi-css-navs5
carousel-multi-css-bullets labelforcml-top-stories65
carousel-multi-css-bullets labelforcml-top-stories75
cml-top-stories8checked carousel-multi-css-navs5
carousel-multi-css-bullets labelforcml-top-stories85
labelforcml-top-stories8 opacity15
cml-top-stories7checked carousel-multi-css-navs5
displayinline-block cml-top-stories7checked5
labelforcml-top-stories6 opacity15
carousel-multi-css--top-stories carousel-multi-css-bullet-65
carousel-multi-css-bullet-6 displayinline-block5
cml-top-stories2checked carousel-multi-css-navs5
carousel-multi-css-bullets labelforcml-top-stories25
carousel-multi-css--top-stories carousel-multi-css-wrapper5
displayblock cml-top-stories0checked5
left -05
-0 cml-top-stories0checked5
carousel-multi-css-wrapper width5
carousel-multi-css--top-stories carousel-multi-css-item-ctn5
labelforcml-top-stories4 opacity15
carousel-multi-css-bullets labelforcml-top-stories45
carousel-multi-css-item-ctn width5
cml-top-stories0checked carousel-multi-css-navs5
10px cml-top-stories6checked5
carousel-multi-css-bullets labelforcml-top-stories05
cml-top-stories3checked carousel-multi-css-navs5
labelforcml-top-stories0 opacity15
labelforcml-top-stories2 opacity15
carousel-multi-css-bullets labelforcml-top-stories35
labelforcml-top-stories3 opacity15
cml-top-stories5checked carousel-multi-css-navs5
false if5
cml-top-stories4checked carousel-multi-css-navs5
cml-top-stories9checked carousel-multi-css-navs5
labelforcml-top-stories7 opacity15
10px cml-top-stories2checked5
f105 cml-top-stories2checked5
inherit cml-top-stories2checked5
f104 cml-top-stories3checked5
f104 cml-top-stories2checked5
cml-top-stories-label0before text-indent5
carousel-multi-css-ctn cml-top-stories-label05
carousel-multi-css-bullets labelforcml-top-stories95
inherit cml-top-stories1checked5
carousel-multi-css-ctn cml-top-stories-label0before5
10px cml-top-stories3checked5
f105 cml-top-stories3checked5
10px cml-top-stories5checked5
f105 cml-top-stories5checked5
inherit cml-top-stories5checked5
f104 cml-top-stories6checked5
f104 cml-top-stories5checked5
inherit cml-top-stories4checked5
inherit cml-top-stories3checked5
f104 cml-top-stories4checked5
10px cml-top-stories4checked5
f105 cml-top-stories4checked5
10px cml-top-stories1checked5
cml-top-stories-label0 display5
labelforcml-top-stories11 opacity15
cml-top-stories12checked carousel-multi-css-navs5
carousel-multi-css-bullets labelforcml-top-stories125
labelforcml-top-stories12 opacity15
carousel-multi-css-bullets labelforcml-top-stories115
cml-top-stories11checked carousel-multi-css-navs5
labelforcml-top-stories9 opacity15
cml-top-stories10checked carousel-multi-css-navs5
carousel-multi-css-bullets labelforcml-top-stories105
labelforcml-top-stories10 opacity15
carousel-multi-css-bullet-12 displayinline-block5
carousel-multi-css--top-stories carousel-multi-css-bullet-125
cml-top-stories14checked carousel-multi-css-navs5
carousel-multi-css-bullets labelforcml-top-stories145
labelforcml-top-stories14 opacity15
10px cml-top-stories0checked5
carousel-multi-css-bullets labelforcml-top-stories135
labelforcml-top-stories13 opacity15
cml-top-stories13checked carousel-multi-css-navs5
displayinline-block cml-top-stories13checked5
ssd review4
graphics card4
tabs-nav tabs-prev-nexttab-home-news-34
card prices4
attr name4
labelbefore opacity54
tabs-nav tabs-prev-nexttab-home-forum-24
deals save4
tabs-nav tabs-prev-nexttab-home-forum-34
tabs-nav tabs-prev-nexttab-home-news-24
af261e cml-top-stories8checked4
carousel-multi-css-ctn cml-top-stories-label-1before4
cml-top-stories-label-1 display4
cml-top-stories-label-1before text-indent4
carousel-multi-css-ctn cml-top-stories-label154
carousel-multi-css-ctn cml-top-stories-label15before4
cml-top-stories-label15 display4
carousel-multi-css-ctn cml-top-stories-label-14
af261e cml-top-stories14checked4
af261e cml-top-stories2checked4
f104 media4
function event4
af261e cml-top-stories6checked4
af261e cml-top-stories12checked4
cml-top-stories-label15before text-indent4
left -333333333333334
graphics cards4
nvidia geforce4
gtmdatalayer undefined4
undefined rn3
my pc3
event rn3
rn gtmdatalayerpushevent3
class value3
href value3
name href3
tabs-prev-nexttab-home-forum-4 labelbefore3
gtmdatalayer typeof3
tabs-prev-nexttab-home-forum-1 labelbefore3
name class3
false rn3
ec-popup-modal-content top-text3
typeof gtmdatalayer3
else rn3
-1 rn3
left -233333333333333
carousel-multi-css-ctn cml-top-stories-label-23
af261e cml-top-stories0checked3
af261e cml-top-stories11checked3
cml-top-stories-label-2 display3
carousel-multi-css-ctn cml-top-stories-label-2before3
carousel-multi-css-ctn cml-top-stories-label163
cml-top-stories-label-2before text-indent3
af261e cml-top-stories9checked3
af261e cml-top-stories5checked3
af261e cml-top-stories4checked3
left -1503
left -503
af261e cml-top-stories10checked3
left -666666666666673
left -133333333333333
af261e cml-top-stories3checked3
cml-top-stories-label16 display3
carousel-multi-css-ctn cml-top-stories-label16before3
onyx 650w3
nytro 1413
asrock fatal1ty3
25 cryptocurrencies3
left -4003
left -3003
tabs-prev-nexttab-home-news-1 labelbefore3
gaming laptop3
ge63vr raider3
monitor review3
cml-top-stories-label16before text-indent3
gtx 10503
1050 ti3
1060 graphics3
core i93
tabs-prev-nexttab-home-news-4 labelbefore3
carousel-multi-css-ctn355
content156
display149
block149
right143
text-indent140
099
carousel-multi-css-wrapper80
left79
background-color78
none77
opacity175
carousel-multi-css-navs75
af261e75
box-shadow75
-075
carousel-multi-css-bullets75
10px74
rn72
f10570
left10px70
inherit70
f10470
leftinherit70
carousel-multi-css--top-stories51
var44
tabs-nav44
if43
displayinline-block34
cml-top-stories6checked30
cml-top-stories10checked30
cml-top-stories11checked30
cml-top-stories12checked30
cml-top-stories13checked30
cml-top-stories9checked30
cml-top-stories8checked30
cml-top-stories2checked30
cml-top-stories4checked30
cml-top-stories5checked30
cml-top-stories7checked30
cml-top-stories1checked30
cml-top-stories3checked30
name25
123
value21
221
cml-top-stories0checked20
cml-top-stories14checked20
labelbefore20
review20
318
windowtmntag18
sep16
width15
function14
false14
tom039s13
412
my12
gaming12
label11
get11
deals11
511
undefined11
graphics11
gtx11
cml-top-stories-label8before10
cml-top-stories-label610
cml-top-stories-label6before10
cml-top-stories-label710
laptop10
hardware10
cml-top-stories-label7before10
cml-top-stories-label810
cpu10
screen9
position9
new9
gtmdatalayer9
msi9
save9
ec-popup-modal-content9
action9
windowtmntagcmd9
tmntagcmdpushfunction9
next9
true9
tmntagadtag9
cml-top-stories-label48
cml-top-stories-label4before8
cml-top-stories-label3before8
cml-top-stories-label38
cml-top-stories-label11before8
background-color9898988
cml-top-stories-label58
cml-top-stories-label5before8
colorfff8
cml-top-stories-label98
cml-top-stories-label108
cml-top-stories-label10before8
cml-top-stories-label118
cml-top-stories-label9before8
tabs-content8
margin-right3pxdisplayinline-blockfloatleft8
all8
00ab8
margin-left3pxdisplayinline-blockfloatright8
00bb8
previous8
deal8
vr8
67
cml-top-stories-label27
tab-home-forum-4checked7
cml-top-stories-label2before7
cml-top-stories-label127
daily7
cml-top-stories-label12before7
card7
tab-home-forum-1checked7
tab-home-news-1checked7
use7
event7
ssd7
you7
tab-home-news-4checked7
off7
tab-home-news-2checked6
geforce6
market6
tab-home-news-3checked6
coming6
gigabyte6
76
tab-home-forum-2checked6
have6
typeof6
cml-top-stories-label13before6
e6
now6
cml-top-stories-label1before6
cml-top-stories-label136
cml-top-stories-label16
memory6
media6
tab-home-forum-3checked6
type5
85
popup5
95
105
catch5
documentcreateelementdiv5
rntttttt5
top5
color5
i95
available5
pc5
tabs-prev-nexttab-home-news-45
115
any5
tabs-prev-nexttab-home-forum-15
125
can5
tabs-prev-nexttab-home-news-15
tabs-prev-nexttab-home-forum-45
asrock5
labelforcml-top-stories65
labelforcml-top-stories55
carousel-multi-css-bullet-65
labelforcml-top-stories75
labelforcml-top-stories85
135
labelforcml-top-stories45
labelforcml-top-stories25
storage5
cml-top-stories-label0before5
build5
latest5
labelforcml-top-stories95
cml-top-stories-label14before5
labelforcml-top-stories145
cml-top-stories-label145
cml-top-stories-label05
labelforcml-top-stories135
carousel-multi-css-bullet-125
more5
labelforcml-top-stories105
labelforcml-top-stories115
labelforcml-top-stories125
monitor5
labelforcml-top-stories35
motherboards5
labelforcml-top-stories05
games5
displayblock5
carousel-multi-css-item-ctn5
your5
nvidia5
group5
custom5
labelforcml-top-stories15
carousel-multi-css-bullet-05
145
155
elem4
laptops4
help4
attr4
js4
rnttvar4
rntttvar4
cards4
vs4
gpu4
asus4
max-width4
164
id4
target4
not4
core4
tabs-prev-nexttab-home-forum-24
else4
tabs-prev-nexttab-home-forum-34
edition4
amd4
but4
samsung4
font-size4
only4
opacity54
174
acer4
padding4
184
cml-top-stories-label-1before4
cml-top-stories-label154
tabs-prev-nexttab-home-news-34
cml-top-stories-label15before4
form4
ti4
articles4
rgb4
popular4
performance4
gtmdatalayerpushevent4
x2994
return4
prices4
amp4
idctwidget4
seagate4
cml-top-stories-label-14
tabs-prev-nexttab-home-news-24
min-width4
tech4
up4
privacy4
194
4k4
buy4
keyboard4
us4
scookie4
mechanical4
class3
subscribed3
window3
match3
newdiv3
own3
ec-popup-modal3
rntt3
question3
documentcreateelementspan3
button3
advice3
pro3
servicelist3
terms3
top-text3
height3
url3
site3
policy3
rnttttt3
engb3
brandcolor3
formrntttvar3
search3
margin-top3
cpus3
close3
center3
href3
15px3
203
213
223
cml-top-stories-label-23
cml-top-stories-label-2before3
cml-top-stories-label16before3
cml-top-stories-label163
233
243
october3
253
hack3
equifax3
039overwatch0393
263
cryptocurrencies3
raider3
16gb3
ge63vr3
case3
keycap3
fatal1ty3
professional3
650w3
psu3
onyx3
273
nytro3
283
demo3
should3
software3
has3
line3
293
303
notebooks3
good3
need3
boot3
fans3
no3
upgrade3
black3
oc3
313
intel3
production3
makes3
out3
google3
without3
unveils3
323
platform3
look3
track3
device3

What are the nameservers for tomshardware.co.uk?

Tomshardware.co.uk Domain Nameserver Information

HostIP AddressCountry
ns-1285.awsdns-32.org 205.251.197.5United States United States
ns-1602.awsdns-08.co.uk 205.251.198.66United States United States
ns-171.awsdns-21.com 205.251.192.171United States United States
ns-933.awsdns-52.net 205.251.195.165United States United States

Tomshardware.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Tomshardware.co.uk is a scam?