Towcester-vets.co.uk Favicon Towcester-vets.co.uk

Towcester-vets.co.uk Website Thumbnail
Checking...
Vets in Northamptonshire - Small Animal, Farm and Equine
Low trust score
Add a review Change category Claim this site
Multi disciplinary RCVS accredited practice providing gold standard care for your animals, evidence based treatment and our own 24/7 emergency service.


Domain summary

Domain label
towcester-vets
Domain extension
co.uk
Domain registered:
21-May-2002
Domain updated:
23-Jun-2020
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is towcester-vets.co.uk ranked relative to other sites:

Percentage of visits to towcester-vets.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Towcester-vets.co.uk registered?
A: Towcester-vets.co.uk was registered 18 years, 5 months, 1 week, 1 day, 8 hours, 38 minutes, 51 seconds ago on Tuesday, May 21, 2002.
Q: When was the WHOIS for Towcester-vets.co.uk last updated?
A: The WHOIS entry was last updated 4 months, 6 days, 8 hours, 38 minutes, 51 seconds ago on Tuesday, June 23, 2020.
Q: What are Towcester-vets.co.uk's nameservers?
A: DNS for Towcester-vets.co.uk is provided by the following nameservers:
  • ns1.livedns.co.uk
  • ns2.livedns.co.uk
Q: Who is the registrar for the Towcester-vets.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Towcester-vets.co.uk?
A: Towcester-vets.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Towcester-vets.co.uk each day?
A: Towcester-vets.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Towcester-vets.co.uk resolve to?
A: Towcester-vets.co.uk resolves to the IPv4 address 80.82.120.31.
Q: In what country are Towcester-vets.co.uk servers located in?
A: Towcester-vets.co.uk has servers located in the United Kingdom.
Q: What webserver software does Towcester-vets.co.uk use?
A: Towcester-vets.co.uk is powered by Nginx webserver.
Q: Who hosts Towcester-vets.co.uk?
A: Towcester-vets.co.uk is hosted by 34SP.com Ltd. in United Kingdom.
Q: How much is Towcester-vets.co.uk worth?
A: Towcester-vets.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Towcester-vets.co.uk?

Towcester-vets.co.uk Hosting Provider Information

Hosted IP Address:80.82.120.31
Hosted Hostname:3125.wp.34sp.com
Service Provider:34SP.com Ltd.
Hosted Country:United KingdomGB
Location Latitude:51.4964
Location Longitude:-0.1224
Webserver Software:nginx

Is "34SP.com Ltd." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Towcester-vets.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Mon, 19 Oct 2020 08:30:46 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://towcester-vets.co.uk/

Towcester-vets.co.uk Domain Nameserver Information

HostIP AddressCountry
ns1.livedns.co.uk 217.160.81.244
ns2.livedns.co.uk 217.160.82.244


Need to find out who hosts Towcester-vets.co.uk?


WhoIs information for Towcester-vets.co.uk

 Domain name:
towcester-vets.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 12-Feb-2013

Registrar:
Fasthosts Internet Ltd [Tag = LIVEDOMAINS]
URL: http://www.fasthosts.co.uk

Relevant dates:
Registered on: 21-May-2002
Expiry date: 21-May-2021
Last updated: 23-Jun-2020

Registration status:
Registered until expiry date.

Name servers:
ns1.livedns.co.uk 217.160.81.244
ns2.livedns.co.uk 217.160.82.244

WHOIS lookup made at 09:30:47 19-Oct-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Towcester-vets.co.uk Free SEO Report

Website Inpage Analysis for Towcester-vets.co.uk

H1 Headings

0 :

H2 Headings

11 :
  1. Your animals, our vets, all the time
  2. Small Animal Department
  3. Farm Animal Department
  4. Dedicated Equine Clinic
  5. Small Animal
  6. Farm Vets
  7. Equine Vets
  8. Surgical Referrals
  9. News and Events
  10. Out of hours emergency service
  11. RCVS accredited independent veterinary centre in Northamptonshire

H3 Headings

0 :

H4 Headings

3 :
  1. Covid-19: PRACTICE UPDATE
  2. Equine asthma
  3. Video consultations for your pets

H5 Headings

3 :
  1. 24 July 2020 by Abii Dowdy
  2. 2 April 2020 by Abii Dowdy
  3. 27 March 2020 by Abii Dowdy

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

22 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-32349268-1

Links - Internal

24:
  1. No text
    http://towcester-vets.co.uk/home
  2. No text
    http://towcester-vets.co.uk/small-animal
  3. No text
    http://towcester-vets.co.uk/farm-animal
  4. No text
    http://towcester-vets.co.uk/surgical-referral
  5. No text
    http://towcester-vets.co.uk/equine
  6. Home
    https://towcester-vets.co.uk/
  7. About Us
    https://towcester-vets.co.uk/about-us/
  8. Blog
    https://towcester-vets.co.uk/blog/
  9. Register
    https://towcester-vets.co.uk/register-with-us/
  10. Symptom Checker
    https://towcester-vets.co.uk/symptom-checker/
  11. Contact Us
    https://towcester-vets.co.uk/contact-us/
  12. No text
    http://towcester-vets.co.uk/small-animal/
  13. No text
    http://towcester-vets.co.uk/farm-animal/
  14. No text
    http://towcester-vets.co.uk/equine/
  15. Small Animal
    https://towcester-vets.co.uk/small-animal/
  16. Farm Vets
    https://towcester-vets.co.uk/farm-animal/
  17. Equine Vets
    https://towcester-vets.co.uk/equine/
  18. Surgical Referrals
    https://towcester-vets.co.uk/surgical-referrals/
  19. News and Events
    http://towcester-vets.co.uk/blog
  20. Covid-19: PRACTICE UPDATE24 July 2020 by Abii Dowdy
    https://towcester-vets.co.uk/2020/07/covid-19-practice-update/
  21. Equine asthma2 April 2020 by Abii Dowdy
    https://towcester-vets.co.uk/2020/04/equine-asthma/
  22. Video consultations for your pets27 March 2020 by Abii Dowdy
    https://towcester-vets.co.uk/2020/03/video-consultations-for-your-pets/
  23. No text
    https://towcester-vets.co.uk/symptom-checker/
  24. Terms & Conditions
    http://towcester-vets.co.uk/about-us/terms-and-conditions/

Links - Internal (nofollow)

0:

Links - Outbound

7:
  1. NN12 6JW
    https://goo.gl/maps/h6UMc
  2. NN7 4QQ
    https://goo.gl/maps/gfWVs
  3. Visit Weedon Vets Website
    http://weedon-vets.co.uk
  4. NN12 6LQ
    https://goo.gl/maps/4VKOf
  5. CV23 8AJ
    https://goo.gl/maps/mCw1x
  6. Visit Onley Vets Website
    http://onley-equine-vets.co.uk
  7. Rather Inventive
    http://ratherinventive.com

Links - Outbound (nofollow)

0:

Keyword Cloud for Towcester-vets.co.uk

practicesmall animalserviceweusenorthamptonshirecarecachemonsterinsightsobjectsendeventpracticeslabelargsanimaltimingundefinedoptionswebsiteteam0smallyourout of hourstierscrolldistanceusfunctionequine vetsevent2020 by abiidepartmentbindscrolldepthreturnhoursourelems2windowonleyallnewtowcesterveterinaryscrolldateyouout01327equine5ifaccreditedfieldsarrayvetsfarmnew datedepthvar4parseintdocheightnowneedsscrolldistance timingtypeofweedon1scroll depth3previousabii

Longtail Keyword Density for Towcester-vets.co.uk

KeywordsOccurences
2020 by abii3
out of hours3
small animal4
scroll depth4
equine vets3
new date3
scrolldistance timing3
if15
var12
function12
vets10
our9
animal8
equine8
your7
farm7
return6
towcester6
scroll6
06
out6
undefined6
veterinary6
previous6
timing5
we5
practice5
013275
you5
northamptonshire5
small5
onley4
scrolldistance4
cache4
care4
fieldsarray4
depth4
website4
us4
hours4
typeof4
14
bindscrolldepth3
options3
event3
elems3
23
33
monsterinsightsobjectsendevent3
args3
parseintdocheight3
label3
weedon3
date3
new3
43
window3
use3
tier3
accredited3
abii3
practices3
service3
team3
53
department3
needs3
all3
now3

Towcester-vets.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Towcenter.org
Tow Center
Towcester-vets.co.uk
Vets in Northamptonshire - Small Animal, Farm and Equine
Towcester.online
Towcester Online – Towcester's Digital Highstreet
Towcesterchiropractic.com
Towcester McTimoney Chiropractic - Welcome
Towcesterleather.co.uk
Leather Goods for every occasion available at Towcester leather
Towcesterplumbers.co.uk
Plumbers in Towcester - Emergency Call Out
Towcestertote.com
Want your own website? | 123 Reg
Towcestertutors.com
Want your own website? | 123 Reg
Towcesterwebdesign.co.uk
Towcester Web Design - Quality Web Design & Development

Recently Updated Websites

Suphansa.com 2 seconds ago.Makeshiftspace.org 2 seconds ago.Doctor-omarov.ru 3 seconds ago.Russiantimes.com 3 seconds ago.Olterm.pl 3 seconds ago.Cfixe.com 4 seconds ago.Lachope.bar 4 seconds ago.Dorothyfeibleman.com 4 seconds ago.10minscoffeebreak.com 5 seconds ago.Reusablenotebook.com 5 seconds ago.T6yk.com 5 seconds ago.Astucesfamille.com 6 seconds ago.Goathaverhill.com 6 seconds ago.Newtrendth.com 7 seconds ago.Longislandmoldassessor.com 7 seconds ago.Radixdance.com 7 seconds ago.Missmartok.com 7 seconds ago.Vieratvnews.com 7 seconds ago.Runskip.com 7 seconds ago.Shilubuluo.com 8 seconds ago.Nghcloud.com 8 seconds ago.Predicas-cristianas.com 8 seconds ago.Ristorantemelograno.com 9 seconds ago.Porterhistory.com 9 seconds ago.Cash2investment.com 10 seconds ago.Roberts-studio.com 10 seconds ago.Baseballprojection.com 11 seconds ago.Largevahomeloans.com 12 seconds ago.Thephotographersephemeris.com 12 seconds ago.Campbellfuneralhomes.com 12 seconds ago.