Futbol üzerinde transferler, söylentiler, piyasa değerleri ve haberler | Transfermarkt

Tüm futbol bilgiler burda. Haberler, transferler, söylentiler ve piyasa değerler.


Domain summary

SafetyLow trust score
Year Founded
2021
Global Traffic Rank
17,246
Estimated Worth
$882,000
Last updated
2021-12-24
Domain label
transfermarkt
Domain extension
com.tr
Statvoo Rating
C
Estimated daily income
$1,225
Estimated monthly income
$37,260

Frequently Asked Questions (FAQ)

Q: When was Transfermarkt.com.tr registered?
A: Transfermarkt.com.tr was registered 6 months, 1 week, 2 days, 17 hours, 16 minutes, 57 seconds ago on Friday, December 24, 2021.
Q: When was the WHOIS for Transfermarkt.com.tr last updated?
A: The WHOIS entry was last updated 6 months, 1 week, 2 days, 17 hours, 16 minutes, 57 seconds ago on Friday, December 24, 2021.
Q: What are Transfermarkt.com.tr's nameservers?
A: DNS for Transfermarkt.com.tr is provided by the following nameservers:
  • pns24.cloudns.net
  • pns22.cloudns.net
  • pns21.cloudns.net
  • pns23.cloudns.net
Q: Who is the registrar for the Transfermarkt.com.tr domain?
A: The domain has been registered at .
Q: What is the traffic rank for Transfermarkt.com.tr?
A: Transfermarkt.com.tr ranks 17,246 globally on Alexa. Transfermarkt.com.tr has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Transfermarkt.com.tr each day?
A: Transfermarkt.com.tr receives approximately 102,053 visitors and 612,318 page impressions per day.
Q: What IP address does Transfermarkt.com.tr resolve to?
A: Transfermarkt.com.tr resolves to the IPv4 address .
Q: In what country are Transfermarkt.com.tr servers located in?
A: Transfermarkt.com.tr has servers located in the .
Q: What webserver software does Transfermarkt.com.tr use?
A: Transfermarkt.com.tr is powered by Nginx webserver.
Q: Who hosts Transfermarkt.com.tr?
A: Transfermarkt.com.tr is hosted by Unknown in .
Q: How much is Transfermarkt.com.tr worth?
A: Transfermarkt.com.tr has an estimated worth of $882,000. An average daily income of approximately $1,225, which is roughly $37,260 per month.

Transfermarkt.com.tr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Transfermarkt.com.tr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Transfermarkt.com.tr

H1 Headings

1 :
  1. Transfermarkt - Söylentili, istatistikli, piyasa değerli ve transferli futbol sayfanız

H2 Headings

10 :
  1. Canlı sonuçlar
  2. Gündem
  3. Süper Lig
  4. 1.Lig
  5. 2.Lig Kırmızı
  6. 2.Lig Beyaz
  7. Top istatistikler
  8. Forumlar
  9. Oyunlar
  10. Yeni haberlerimiz var!

H3 Headings

1 :
  1. En çok tıklanan profiller

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

260 :

Links - Internal

483:

Links - Internal (nofollow)

0:

Links - Outbound

3:

Links - Outbound (nofollow)

0:

Keyword Cloud for Transfermarkt.com.tr

okuligue professionnelle 1mastars league 10haftasahibileagueprofessionnelle 1 9haftacopynbspimago imagesveligueuluslararasfutbolcularsahibi takm konukraporu10 ligueadanasporsayskt26 arasckalecifutbolcularn piyasacanlikarlamalarleague 8hafta10haftadeeri gncellemesipiyasamil00konuk14stars leagueyenitakm cmtcanli 01bin 2kocaelispornbspelcopynbspdha nbspkarlamalar tarih evpazelse26 ara 2021gulf pro league5jspaz 26cmtfenerbaheev sahibigoogletagcmdpushfunction0tavsiyelergncellemesidevam oku6deersper1003professionnellepiyasa deer analizi19haftann karlamalarokpro18hafta1 9hafta9hafta19haftannsc 10persian gulf protruegoltarih evaraaltnordupiyasa deergncellendifalsepersian gulffunctioniingulf protrabzonspordeerleri gncellendideeritarih2tm fikstrfcdeer analizisahibi takm10 ligue professionnelleara 2021nbsp yazyorpaz 26 aracmt 25 aradeerlerileague 11haftakonuk takmbld 13001ligpiyasa deerleri gncellendinanbinpremier league19haftann karlamalar tarihbldpremier leaguedetmspor 1300dakikafikstrtransfermarktpiyasa deerlerimubu7ligue professionnellekonuk takm cmtleaguedevericanli 10 ligueev sahibi takmteknikmcvar01ma raporu11cmt 25premierpiyasa deeri gncellemesi11haftaleague 10haftatakmnaftpro leaguepro league 11haftaevimagestakm konukbilgikarlamalar tarihcopynbspimagooyuncu4takm cmt 25copynbspimago images nbsplig3bolusporprofessionnelle 1canli 00stars13sonra25 araimages nbspbirtakm konuk takmcanli 1012ilkufksporpiyasa deerigulfdeerlitarih ev sahibianalizirc25 ara 2021kulpdevamilealgergalatasaray9persianfutbolcularnyazyorcopynbspdha8o

Longtail Keyword Density for Transfermarkt.com.tr

KeywordsOccurrences
ligue professionnelle 19
gulf pro league8
pro league 11hafta8
persian gulf pro8
piyasa deeri gncellemesi7
professionnelle 1 9hafta6
karlamalar tarih ev4
sahibi takm konuk4
ev sahibi takm4
tarih ev sahibi4
25 ara 20214
19haftann karlamalar tarih4
cmt 25 ara4
paz 26 ara4
26 ara 20214
takm konuk takm4
takm cmt 253
stars league 10hafta3
konuk takm cmt3
copynbspimago images nbsp3
piyasa deerleri gncellendi3
10 ligue professionnelle3
canli 10 ligue3
piyasa deer analizi3
piyasa deeri10
ara 202110
ligue professionnelle9
professionnelle 19
persian gulf8
gulf pro8
pro league8
league 11hafta8
deeri gncellemesi7
devam oku6
nbsp yazyor6
1 9hafta6
images nbsp5
canli 105
ev sahibi4
sahibi takm4
tarih ev4
karlamalar tarih4
19haftann karlamalar4
takm konuk4
konuk takm4
piyasa deerleri4
25 ara4
paz 264
26 ara4
premier leaguede4
tm fikstr4
cmt 254
canli 004
piyasa deer4
ma raporu4
bld 13003
deer analizi3
spor 13003
copynbspimago images3
takm cmt3
stars league3
deerleri gncellendi3
futbolcularn piyasa3
copynbspdha nbsp3
10 ligue3
canli 013
league 8hafta3
premier league3
sc 103
league 10hafta3
bin 23
piyasa21
canli19
018
fc17
117
says16
nbsp15
league15
sc12
ara11
var11
211
ligue10
premier10
deeri10
310
takm9
professionnelle9
tm9
11hafta8
deer8
pro8
008
gulf8
persian8
ma8
oyuncu7
ve7
gncellemesi7
ok7
galatasaray7
spor6
devam6
oku6
yazyor6
el6
016
46
9hafta6
images5
trabzonspor5
fk5
mil5
55
karlamalar5
googletagcmdpushfunction5
65
75
85
raporu5
94
else4
nan4
uluslararas4
bu4
19haftann4
bir4
veri4
kulp4
bld4
tarih4
fikstr4
ev4
sahibi4
paz4
konuk4
cmt4
104
function4
mc4
bilgi4
true4
js4
034
dakika4
rc4
alger4
naft4
114
124
leaguede4
134
gncellendi4
transfermarkt4
yeni4
deerleri4
gol4
adanaspor3
10hafta3
analizi3
8hafta3
stars3
kaleci3
sonra3
u3
deerli3
bin3
kocaelispor3
teknik3
1lig3
lig3
fenerbahe3
sper3
copynbspimago3
futbolcularn3
iin3
mu3
futbolcular3
ilk3
altnordu3
copynbspdha3
tavsiyeler3
false3
o3
kt3
143
boluspor3
ile3

Who hosts Transfermarkt.com.tr?

Transfermarkt.com.tr Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6166%
GOOGLE
14.4366%
AS-26496-GO-DADDY-COM-LLC
3.5285%
NAMECHEAP-NET
3.2196%
AMAZON-AES
2.2918%
GoDaddy.com, LLC
2.0510%
UNIFIEDLAYER-AS-1
2.0307%
Fara Negar Pardaz Khuzestan
1.6758%
CONFLUENCE-NETWORK-INC
1.5015%
AMAZON-02
1.4722%

Transfermarkt.com.tr Domain Nameserver Information

HostIP AddressCountry
pns24.cloudns.net 185.136.99.96
pns22.cloudns.net 185.136.97.96
pns21.cloudns.net 185.136.96.96
pns23.cloudns.net 185.136.98.96

Websites with Similar Names

Trans-4.com
Domein Gereserveerd - Mijndomein.nl
Trans-4m.agency
trans-4m.agency - Registered at Namecheap.com
Trans-4m.management
trans-4m.management - Registered at Namecheap.com
Trans-500.net
Trans500 Porn Tube
Trans-52.ru
Срок регистрации домена закончился
Trans-acc.com
Home • Trans-Acc, Inc.

Recently Updated Websites

Holli.co.uk (6 seconds ago.)Tengshuodz.com (7 seconds ago.)Wallaceandgromitfoundation.org (8 seconds ago.)Theretiredguyhobbyshop.com (8 seconds ago.)Bendonpub.com (10 seconds ago.)963kissfm.iheart.com (11 seconds ago.)Tastebudschange.com (11 seconds ago.)Wondersofrajasthan.com (13 seconds ago.)Rentdart.com (13 seconds ago.)Blikstein.com (14 seconds ago.)Holscot.com (15 seconds ago.)Nocino.com (18 seconds ago.)Secure.getclicky.com (19 seconds ago.)Truronissan.ca (19 seconds ago.)Suboni.com (21 seconds ago.)Luag.org (21 seconds ago.)Raytheonbenifitcenter.com (22 seconds ago.)Greaterstmark.org (22 seconds ago.)Tribepresets.com (23 seconds ago.)Cdn.ampproject.org (24 seconds ago.)Bwaltd.net (24 seconds ago.)Cfood.life (26 seconds ago.)Swiftfuelsavgas.net (26 seconds ago.)Vitafoodssouthamerica.com (26 seconds ago.)Ppgporterpaints.com (28 seconds ago.)Siblac.org (30 seconds ago.)Aas.stanford.edu (31 seconds ago.)Digitaledition.philstar.com (32 seconds ago.)Villawalsh.org (33 seconds ago.)Bosewe.com (33 seconds ago.)

Recently Searched Keywords

style-k4p83pkblabelwrapper (1 second ago.)contato comercial (1 second ago.)sans ã©lastique (1 second ago.)forretningsutvikling (1 second ago.)cnc machine (1 second ago.)txtv100 (1 second ago.)delta-3-carene (1 second ago.)vanhooser (1 second ago.)organization name (1 second ago.)what is the center for emergency medicine and how can i know what it stands for (1 second ago.)power tubes (2 seconds ago.)last weekend (2 seconds ago.)tumwater falls (3 seconds ago.)whole foods market we believe in real food (3 seconds ago.)tumwater falls (3 seconds ago.)sign clamps (3 seconds ago.)digital multimeters (3 seconds ago.)energy prize mit (4 seconds ago.)pussy hot hub (4 seconds ago.)german mature71.0k (4 seconds ago.)persiapkan (5 seconds ago.)gants pure soie (6 seconds ago.)30ningcontningresponsivewindowbindload scalesliderwindowbindresize scalesliderwindowbindorientationchange (6 seconds ago.)винзавод массандра время работы (6 seconds ago.)nigeria embassy in uae (6 seconds ago.)brexit date (7 seconds ago.)14px14em roboto-thinrobotosans-seriftext-decoration (7 seconds ago.)kula (7 seconds ago.)долото (8 seconds ago.)finished false (8 seconds ago.)