|  Transfermarkt
Low trust score  | Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:4,123
Majestic Rank Majestic Rank:16,547
Domain Authority Domain Authority:65%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:

Status: connect
Changed: 2013-06-26T13:47:26+02:00

Name: Hostmaster Of The Day
Organisation: terralink networks GmbH
Address: Wendenstrasse 375
PostalCode: 20537
City: Hamburg
CountryCode: DE
Phone: +49.402846500
Fax: +49.40284650120
Email: Login to show email

Name: Hostmaster Of The Day
Organisation: terralink networks GmbH
Address: Wendenstrasse 375
PostalCode: 20537
City: Hamburg
CountryCode: DE
Phone: +49.402846500
Fax: +49.40284650120
Email: Login to show email

Who hosts is hosted by terralink networks GmbH in Hamburg, Hamburg, Germany, 20537. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service Provider:terralink networks GmbH
Hosted Country:GermanyDE
Location Latitude:53.5753
Location Longitude:10.0153
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 08 Jun 2015 15:28:45 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Powered-By: PHP/5.5.24
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

binverbandsligamangesehendusastarget if3targeting smartadserverajaxsaspageid sasformatidsastargetstartseiteifspielenhattv nbspwertvollstenbleibtunsnewsimabervflallemio nbspneuzugangfrauswennjetztsolltebeiinnenverteidiger2llsastargettvnbsp nbsp nbsptopelf jahrgangeinif sasnoadnbsp schreibtliverpoolzuhwedestargeting smartadserverajaxsaspageides gehtwirpremier leagueaktuelleichspieleraktvonbjuniorenligasasnoadlsstsportingsastargetstartseite targetingsdwestlandesligamittelstrmerbayerntopelferajuniorenvordieesdi maramirabonnentenegalsasnoadfalsespielerposition vereinzurbundesliga0das spielkmpfenpersnlichdieserimmerverteidigersasformatid sastarget ifsasnoadfalse saspageid59638homenordregionalligaoderdirfcletztenderspielerpositionsasformatidnochistverein fcbeimtop 10 diemarktwertajunioren bundesligasogerchtekche1sindwrehiersastargetstartseite targeting smartadserverajaxsaspageidmio alleweiterlesenwirdoftwertvollsten spielermittelfeldoberligazumschlechtsastarget if sasnoadvlstatistikendie wertvollsten spielerihmpremiervarauchwarfehlermitdemmio verein fclautcopynbspimago nbspletztenichthabenizzamaragerchtespielersmartadserverajaxsaspageid sasformatid sastargetbjunioren bundesligawie56disasformatid sastargetvereinleaguedaviewsmio vereintransfermarkt tv nbsptop 10einenkanneinemalsspielgehtsmartadserverajaxsaspageidcopynbspimago7videobeweistransfersmehrmiodie wertvollstennbsp10 diesvtsddensehrbeliebtheitsranglisteeinejonathasjafunctiontransfermarkt tvnbsp nbsptopschreibtdasstransfermarktfc liverpoolwestdanntargetingclucasneueaufhoffenheimjahrgangstartseitesaspageid59638home10 die wertvollstendessichdassmartadserverajaxsaspageid sasformatid4gespieltnachjuventus

Longtail Keyword Density for

sastargetstartseite targeting smartadserverajaxsaspageid6
sastarget if sasnoad6
sasformatid sastarget if6
smartadserverajaxsaspageid sasformatid sastarget6
targeting smartadserverajaxsaspageid sasformatid6
top 10 die5
10 die wertvollsten5
die wertvollsten spieler3
nbsp nbsp nbsp3
mio verein fc3
transfermarkt tv nbsp3
mio nbsp9
mio verein9
copynbspimago nbsp8
top 107
top-elf jahrgang7
smartadserverajaxsaspageid sasformatid6
targeting smartadserverajaxsaspageid6
sastargetstartseite targeting6
fc liverpool6
sasnoadfalse saspageid59638home6
nbsp schreibt6
sasformatid sastarget6
if sasnoad6
sastarget if6
10 die5
die wertvollsten5
premier league4
spielerposition verein4
nbsp nbsp4
mio alle3
es geht3
das spiel3
verein fc3
b-junioren bundesliga3
a-junioren bundesliga3
di mara3
transfermarkt tv3
tv nbsp3
wertvollsten spieler3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Germany Germany Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?