Transgen.de  |  transGEN - Transparenz Gentechnik: Pflanzen, Forschung, Landwirtschaft, Lebensmittel
Low trust score  | 
Grüne Gentechnik bei Nutzpflanzen, Lebensmitteln, Zutaten, Zusatzstoffen und Enzymen. Gentechnisch veränderte Pflanzen in der Landwirtschaft: Anbau, Zulassungen, Erfahrungen, Nutzen und Risiken. Pflanzenforschung: Ziele und Verfahren

Transgen.de Website Information

Transgen.de has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 970,554, a Majestic Rank of 263,429, a Domain Authority of 56% and is not listed in DMOZ.

Transgen.de is hosted by OpenIT GmbH in North Rhine-westphalia, Dusseldorf, Germany, 40595.
Transgen.de has an IP Address of 217.69.73.14 and a hostname of www2.webmotive.net and runs Apache (Unix) web server.

The domain transgen.de was registered 201 decades 8 years 9 months ago by , it was last modified 1 decade 2 years 6 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for transgen.de

Full Whois Lookup for Transgen.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: transgen.de
Nserver: ns.webmotive.net
Nserver: ns3.webmotive.net
Status: connect
Changed: 2007-10-24T22:41:05+02:00

[Tech-C]
Type: PERSON
Name: Christian Haase
Address: www.webmotive.net
Address: Luisenstr. 20
PostalCode: 52070
City: Aachen
CountryCode: DE
Phone: +49-24116035904
Fax: +49-24116035908
Email: Login to show email
2007-01-08T12:34:40+01:00

[Zone-C]
Type: PERSON
Name: Christian Haase
Address: www.webmotive.net
Address: Luisenstr. 20
PostalCode: 52070
City: Aachen
CountryCode: DE
Phone: +49-24116035904
Fax: +49-24116035908
Email: Login to show email
2007-01-08T12:34:40+01:00

Who hosts Transgen.de?

Transgen.de Web Server Information

Hosted IP Address:217.69.73.14
Hosted Hostname:www2.webmotive.net
Service Provider:OpenIT GmbH
Hosted Country:GermanyDE
Location Latitude:51.217
Location Longitude:6.767
Webserver Software:Apache (Unix)

HTTP Header Analysis for Transgen.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 26 Sep 2015 17:07:01 GMT
Server: Apache (Unix)
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=iso-8859-1


Need to find out who hosts Transgen.de?

Transgen.de Free SEO Report

Website Inpage Analysis for Transgen.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Transgen.de

pflanzenes0ngsidebarextbtnsumfunktioniertsiezumaucheinebeiforschunggentechnikistwienbspdasbackgroundzuauslebensmittelneueimpflanzenschutzfrgenome editingdiegenomewirdtransgencrisprcaseditingverfahrendermitcrisprmiddot

Longtail Keyword Density for Transgen.de

KeywordsOccurences
genome editing3
der12
die8
ngsidebarextbtns8
wie7
mit6
06
gentechnik5
bei5
das5
um5
sie5
zu5
es4
ist4
zum4
nbsp4
wird4
aus4
pflanzen4
crisprcas4
middot3
eine3
background3
forschung3
lebensmittel3
verfahren3
funktioniert3
editing3
genome3
auch3
pflanzenschutz3
neue3
fr3
crispr3
im3
transgen3

What are the nameservers for transgen.de?

Transgen.de Domain Nameserver Information

HostIP AddressCountry
ns.webmotive.net 217.69.73.2Germany Germany
ns3.webmotive.net 78.47.176.36Germany Germany

Transgen.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Transgen.de is a scam?