Welcome to Translate This

Safety: Low trust score
Year Founded: 2017
Global Traffic Rank: 228,379
Estimated Worth: $41,040
Category: This site has not been categorized yet



Domain summary

Last updated
2021-09-08
Domain label
translateth
Domain extension
is
Domain registered:
2017-02-13
Domain updated:
2021-09-08
Domain expires:
2022-02-13
Global Traffic Rank
228,379
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$41,040
Estimated daily income
$76
Estimated monthly income
$2,312

Frequently Asked Questions (FAQ)

Q: When was Translateth.is registered?
A: Translateth.is was registered 4 years, 7 months, 1 week, 1 day, 5 hours, 32 minutes, 54 seconds ago on Monday, February 13, 2017.
Q: When was the WHOIS for Translateth.is last updated?
A: The WHOIS entry was last updated 1 week, 6 days, 5 hours, 32 minutes, 54 seconds ago on Wednesday, September 8, 2021.
Q: What are Translateth.is's nameservers?
A: DNS for Translateth.is is provided by the following nameservers:
  • ns-1761.awsdns-28.co.uk
  • ns-1309.awsdns-35.org
  • ns-750.awsdns-29.net
  • ns-289.awsdns-36.com
Q: Who is the registrar for the Translateth.is domain?
A: The domain has been registered at ISNIC.
Q: What is the traffic rank for Translateth.is?
A: Translateth.is ranks 228,379 globally on Alexa. Translateth.is has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Translateth.is each day?
A: Translateth.is receives approximately 6,743 visitors and 26,972 page impressions per day.
Q: What IP address does Translateth.is resolve to?
A: Translateth.is resolves to the IPv4 address 54.91.102.92.
Q: In what country are Translateth.is servers located in?
A: Translateth.is has servers located in the United States.
Q: What webserver software does Translateth.is use?
A: Translateth.is is powered by Apache/2.4.46 (Unix) OpenSSL/1.0.2k-fips webserver.
Q: Who hosts Translateth.is?
A: Translateth.is is hosted by AMAZON-AES in Virginia, Ashburn, United States, 20149.
Q: How much is Translateth.is worth?
A: Translateth.is has an estimated worth of $41,040. An average daily income of approximately $76, which is roughly $2,312 per month.

Translateth.is Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Translateth.is Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Translateth.is

H1 Headings

0 :

H2 Headings

1 :
  1. 5 Professional Traits That A Professional Translator Should Have

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

12 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

46:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Translateth.is

theretranslation servicepostedtranslatorprofessional05 feb 21feb 2121 021 postedmoreneedtranslation servicesweserviceadministrator 0 viewsadministrator 0takeyou canbackmostviewspianoalso0 favsservicesourcommoncantodayinternetwebsitefeb 21 00 0rightshoesvar0 views 0frenchyoufeb 21 postedfeblookingverybusinessadministratorblogsnewsyourtheybest1whyposted by administratorviews 0 favsviews 0dolanguage21 0 0theirnotcontactpeoplemaynumberone0 viewslessonsall005ifupcompaniesfavs05 febcompanylearngetfindhavetranslationif youfind the best

Who hosts Translateth.is?

Translateth.is Hosting Provider Information

Hosted IP Address:54.91.102.92
Hosted Hostname:ec2-54-91-102-92.compute-1.amazonaws.com
Service Provider:AMAZON-AES
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4728
Webserver Software:Apache/2.4.46 (Unix) OpenSSL/1.0.2k-fips

Is "AMAZON-AES" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%

HTTP Header Analysis for Translateth.is

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 08 Sep 2021 04:04:10 GMT
Server: Apache/2.4.46 (Unix) OpenSSL/1.0.2k-fips
X-Powered-By: PHP/7.4.0
Cache-Control: max-age=15552000
Expires: Mon, 07 Mar 2022 04:04:10 GMT
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 5542
Content-Type: text/html; charset=UTF-8

Translateth.is Domain Nameserver Information

HostIP AddressCountry
ns-1761.awsdns-28.co.uk 205.251.198.225
ns-1309.awsdns-35.org 205.251.197.29
ns-750.awsdns-29.net 205.251.194.238
ns-289.awsdns-36.com 205.251.193.33


Need to find out who hosts Translateth.is?


Domain Registration (WhoIs) information for Translateth.is

 % This is the ISNIC Whois server.
%
% Rights restricted by copyright.
% See https://www.isnic.is/en/about/copyright

domain: translateth.is
registrant: AM310-IS
admin-c: AM310-IS
tech-c: AM310-IS
zone-c: AR64-IS
billing-c: AM310-IS
nserver: ns-1761.awsdns-28.co.uk
nserver: ns-1309.awsdns-35.org
nserver: ns-750.awsdns-29.net
nserver: ns-289.awsdns-36.com
dnssec: unsigned delegation
created: February 13 2017
expires: February 13 2022
source: ISNIC

nic-hdl: AM310-IS
address: US
created: February 22 2017
source: ISNIC

role: Amazon Route 53
nic-hdl: AR64-IS
address: Amazon.com
address: P.O. Box 81226
address: Seattle, Washington 98108-1226
address: US
e-mail: Login to show email
September 14 2011
source: ISNIC

Websites with Similar Names

Trans-4.com
Domein Gereserveerd - Mijndomein.nl
Trans-4m.agency
trans-4m.agency - Registered at Namecheap.com
Trans-4m.management
trans-4m.management - Registered at Namecheap.com
Trans-500.net
Trans500 Porn Tube
Trans-52.ru
Срок регистрации домена закончился
Trans-academics.org
Trans-Academics.org
Trans-acc.com
Home • Trans-Acc, Inc.

Recently Updated Websites

Cinemabattleroyal.com (5 seconds ago.)Shippeesolarconstruction.com (6 seconds ago.)Denisemalenfant.com (8 seconds ago.)Parihost.com (8 seconds ago.)Pridajlink.sk (8 seconds ago.)Great-lite.com.tw (9 seconds ago.)Btech.com.vn (10 seconds ago.)Cdmcookstovekoppal.in (11 seconds ago.)Hydrolyzedsponge.com (12 seconds ago.)Carbomar-nautica.com (12 seconds ago.)Edengardeningservices.com (12 seconds ago.)Squarerobot.biz (13 seconds ago.)Elitesigningservices.org (14 seconds ago.)Bawza.com (14 seconds ago.)Wonderful-videos.com (16 seconds ago.)Crickettogether.com (16 seconds ago.)Swgfex.org (17 seconds ago.)Tt-sv-blau-weiss.de (18 seconds ago.)Event2one.com (20 seconds ago.)Talented-you.com (21 seconds ago.)Cloudtidings.com (21 seconds ago.)Ayeghgroup.com (22 seconds ago.)Cardial.org (23 seconds ago.)Aoa951.vip (23 seconds ago.)Kokbet7031.com (23 seconds ago.)Tedlinespiritualwarfarecovering.info (24 seconds ago.)Bitcoinyuma.com (24 seconds ago.)Ultrafatloss.net (24 seconds ago.)Passionatewanderers.com (27 seconds ago.)Harshitspices.com (28 seconds ago.)

Recently Searched Keywords

nauk publication (2 seconds ago.)furnituremattress (3 seconds ago.)font-size 19px (4 seconds ago.)laikrodžiai (6 seconds ago.)mot du président (6 seconds ago.)rgba8 50 4 (6 seconds ago.)clerical - administrative (9 seconds ago.)lyntaylor hd es 25 party chat special show (12 seconds ago.)20 off entire (13 seconds ago.)related party (13 seconds ago.)vindictive (14 seconds ago.)sucos (16 seconds ago.)גובלן לריפוד (17 seconds ago.)coal mining (18 seconds ago.)x041ex043fx0443x0431x043bx0438x043ax043ex0432x0430x043dx043e navis (18 seconds ago.)see sport mittag (21 seconds ago.)anuncios gratuitos (21 seconds ago.)ju-jitsu (23 seconds ago.)90000 102 documentreadyfunction (23 seconds ago.)miliaria (23 seconds ago.)border-left-style (25 seconds ago.)vitrified (26 seconds ago.)tvisha (26 seconds ago.)sosta (27 seconds ago.)keysight chi 330 triệu usd mua lại công ty kiểm thử phần mềm eggplant (28 seconds ago.)todas as bonecas (28 seconds ago.)center cursor (31 seconds ago.)klinik (32 seconds ago.)thetamarindtree (33 seconds ago.)again und die (33 seconds ago.)