Traveldex.co.za  |  South Africa travel & tourism directory for visitors to South Africa
Low trust score  | 
South Africa travel & tourism directory - Accommodation, car rental, tours, cheap flights and more. South Africa travel information at your fingertips.




Traveldex.co.za Website Information

Website Ranks & Scores for Traveldex.co.za

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:2,230,249
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:37%
DMOZ DMOZ Listing:Yes

Domain Information for Traveldex.co.za

Domain Registrar: UniForum Association
Last Modified:2006-01-09  1 decade 3 years 5 months ago
Owner's E-Mail:Login to show email

Whois information for traveldex.co.za

Full Whois Lookup for Traveldex.co.za Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Traveldex.co.za. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

simple CO.ZA whois server
The CO.ZA simple whois server
© Copyright ZACR 1995-2017
Use of this facility subject to theterms of site usage
Your query has generated the following reply:-

Search on traveldex (.co.za)
Match: One

Domain: traveldex.co.za

Accounting info....
Date |Type| Cost |Invoices are E-Mail to....|Paid Date |ICnt| TrkNo |Billing Info
2006-09-01| N | Login to show email
|2006-09-01| 1 | 635098|SA-Nethost.com
2007-10-01| R | Login to show email
|2007-11-30| 2 | 836705|SA-Nethost.com
2008-10-01| R | Login to show email
|2009-01-22| 4 | 1070668|SA-Nethost.com
2009-10-01| R | Login to show email
|2009-12-10| 3 | 1374692|SA-Nethost.com
2010-10-01| R | Login to show email
|2011-01-03| 4 | 1681597|SA-Nethost.com
2011-10-03| R | Login to show email
|2012-02-17| 5 | 2009387|SA-Nethost.com
2012-10-02| R | Login to show email
|2012-12-06| 3 | 2353202|SA-Nethost.com
2013-10-01| R | Login to show email
|2013-10-24| 1 | 2542851|SA-Nethost.com
2014-10-01| R | Login to show email
|2014-10-01| 1 | 2653874|SA-Nethost.com
2015-10-01| R | Login to show email
|2015-11-20| 2 | 2737343|SA-Nethost.com
2016-10-03| R | Login to show email
|2016-11-22| 2 | 2794147|SA-Nethost.com

Flashing RED indicates that payment has not been received - please
confirm with the ZACR accounting department, Login to show email
should this
not be according to your records. You have been sent 0 invoices/statements.

0a. lastupdate : 2006/09/01 09:27:57+02
0b. emailsource : Login to show email
emailposted : Fri, 1 Sep 2006 09:27:43 +0200
0d. emailsubject :
0g. historycount : 1
0h. invoiceno : 635098
0i. contracttype : NEW
0j. rcsversion : $Revision: 1.138 $ $Date: 2006/07/11 13:22:53 $
1a. domain : traveldex.co.za
1b. action : N
1c. Registrar : ZACR
2a. registrant : SA-Nethost.com
2b. registrantpostaladdress: PO Box 44905, Claremont, 7735,-, , , --
2c. registrantstreetaddress:
2d. amount : 50.00
2e. paymenttype : I
2f. billingaccount : SA-Nethost.com
2g. billingemail : Login to show email
invoiceaddress : PO Box 44905, Claremont, 7735
2j. registrantphone : +27.823521191
2k. registrantfax : +27.866416533
2l. registrantemail : Login to show email
vat :
3b. cname :
3c. cnamesub1 :
3d. cnamesub2 :
3e. creationdate : 2006/09/01 09:27:57
4a. admin : Master, Host
4b. admintitle : Technical
4c. admincompany : SA-Nethost.com
4d. adminpostaladdr : PO Box 44905, Claremont, 7735
4e. adminphone : +27823521191
4f. adminfax : 0866 416 533
4g. adminemail : Login to show email
adminnic :
5a. tec : Master, Host
5b. tectitle : Technical
5c. teccompany : SA-Nethost.com
5d. tecpostaladdr : PO Box 44905, Claremont, 7735
5e. tecphone : +27823521191
5f. tecfax : 0866 416 533
5g. tecemail : Login to show email
tecnic :
6a. primnsfqdn : dns1.supremecenter36.com
6b. primnsip :
6c. primnsipv6 :
6e. secns1fqdn : dns2.supremecenter36.com
6f. secns1ip :
6g. secns1ipv6 :
6i. secns2fqdn :
6j. secns2ip :
6k. secns2ipv6 :
6m. secns3fqdn :
6n. secns3ip :
6o. secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
6s. secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
8c. netblock2start :
8d. netblock2end :
8e. netblock3start :
8f. netblock3end :
9a. description1 :
9b. description2 :
9c. description3 :
9d. description4 :
9e. description5 :
9f. description6 :

Next Query - Domain name
.co.za
Please refer to the CO.ZA contact details should you have any problems

Who hosts Traveldex.co.za?

Traveldex.co.za is hosted by Steadfast Networks in United States.
Traveldex.co.za has an IP Address of 162.210.102.58 and a hostname of 162.210.102.58 and runs Apache mod_fcgid/2.3.7 mod_auth_pgsql/2.0.3 web server.



Traveldex.co.za Web Server Information

Hosted IP Address:162.210.102.58
Hosted Hostname:162.210.102.58
Service Provider:Steadfast Networks
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Apache mod_fcgid/2.3.7 mod_auth_pgsql/2.0.3

HTTP Header Analysis for Traveldex.co.za

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 26 May 2015 03:38:14 GMT
Server: Apache mod_fcgid/2.3.7 mod_auth_pgsql/2.0.3
Vary: User-Agent,Accept-Encoding
Content-Encoding: gzip
Content-Length: 4686
Content-Type: text/html


Need to find out who hosts Traveldex.co.za?

Traveldex.co.za Free SEO Report

Website Inpage Analysis for Traveldex.co.za

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Traveldex.co.za

alltravelifnewcapefreelinksdirectorytraveldexafricaaccommodation travel servicesemailtravel and tourismif younbspsouth africa travelafrica travelaccommodationaccommodation travelnewslettertravel servicestransportsearchadventuresouth africasportyourserviceswebsiteustourismsouthadventure and sportraquopageyoulinkregisterwewebsitescategory

Longtail Keyword Density for Traveldex.co.za

KeywordsOccurences
accommodation travel services6
adventure and sport4
travel and tourism4
south africa travel4
travel services10
south africa7
accommodation travel6
if you4
africa travel4
travel18
accommodation10
services10
you9
south7
africa7
your7
tourism6
all6
websites5
directory5
new4
category4
if4
sport4
adventure4
raquo4
nbsp4
link4
search4
links4
transport4
us3
newsletter3
page3
we3
email3
free3
cape3
traveldex3
register3
website3

What are the nameservers for traveldex.co.za?

Traveldex.co.za Domain Nameserver Information

HostIP AddressCountry
dns1.supremecenter36.com 198.23.54.4United States United States
dns2.supremecenter36.com 198.23.56.4United States United States

Traveldex.co.za Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Traveldex.co.za is a scam?