Treppenlift-magazin.de  |  Treppenlift - Preise, Anbieter und Infos für Treppenlifte
Low trust score  | 
Viele Informationen und unabhängige Tipps zu einem Treppenlift, die vor allem dabei helfen, den besten Anbieter zu finden.

Treppenlift-magazin.de Website Information

Treppenlift-magazin.de has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 2,928,816, a Majestic Rank of 0, a Domain Authority of 46% and is not listed in DMOZ.

Treppenlift-magazin.de is hosted by Neue Medien Muennich GmbH in Saxony, Bautzen, Germany, 02625.
Treppenlift-magazin.de has an IP Address of 85.13.142.125 and a hostname of dd22834.kasserver.com.

The domain treppenlift-magazin.de was registered 201 decades 8 years 11 months ago by , it was last modified 5 years 5 months 4 weeks ago and currently is set to expire 201 decades 8 years 11 months ago.


Whois information for treppenlift-magazin.de

Full Whois Lookup for Treppenlift-magazin.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: treppenlift-magazin.de
Nserver: ns.inwx.de
Nserver: ns2.inwx.de
Nserver: ns3.inwx.eu
Nserver: ns4.inwx.com
Nserver: ns5.inwx.net
Status: connect
Changed: 2013-05-10T12:12:51+02:00

[Tech-C]
Type: ROLE
Name: Hostmaster Of The Day
Organisation: INWX GmbH & Co. KG
Address: Prinzessinnenstr. 30
PostalCode: 10969
City: Berlin
CountryCode: DE
Phone: +49.309832120
Fax: +49.3098321290
Email: Login to show email
role account for Hostmaster of the Day
Changed: 2016-10-11T13:11:06+02:00

[Zone-C]
Type: ROLE
Name: Hostmaster Of The Day
Organisation: INWX GmbH & Co. KG
Address: Prinzessinnenstr. 30
PostalCode: 10969
City: Berlin
CountryCode: DE
Phone: +49.309832120
Fax: +49.3098321290
Email: Login to show email
role account for Hostmaster of the Day
Changed: 2016-10-11T13:11:06+02:00

Who hosts Treppenlift-magazin.de?

Treppenlift-magazin.de Web Server Information

Hosted IP Address:85.13.142.125
Hosted Hostname:dd22834.kasserver.com
Service Provider:Neue Medien Muennich GmbH
Hosted Country:GermanyDE
Location Latitude:51.1825
Location Longitude:14.4292
Webserver Software:Not Applicable

HTTP Header Analysis for Treppenlift-magazin.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 07 Jun 2015 20:50:55 GMT
Server: Apache
X-Powered-By: PHP/5.4.40-nmm1
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 4741
Content-Type: text/html


Need to find out who hosts Treppenlift-magazin.de?

Treppenlift-magazin.de Free SEO Report

Website Inpage Analysis for Treppenlift-magazin.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Treppenlift-magazin.de

wirdhohemarkstr 10122zusammennachtreppenliftenvoninfotreppenliftmagazindebietetauf dendie0fr einelebensehrhngthohemarkstr 1012 61440auchder treppenliftvarbisdies hngtfr einenweiteranbietermehrfestpreisdiesodereinemvomsitzliftdenkostenvon derdurchdamitwird dereinestreppedemistgeradeesaufmenschen1012 61440aber auchdiesezurfrfrderungaberoberurseleinemglichzuschuss dermusssichplattformliftvon treppenliftenhubliftwandmontagegebrauchtenurder treppedesder61440 oberursel061712061660zuschusszumber1012 61440 oberurselkeineder anbieterpreiseseitedie preiseist dereuromenschen diemeist1 1werdendastreppentreppensteigengebrauchte treppenliftegibt11012imalsnichtwird der treppenliftsindzudasskaufzudemertreppenliftehohemarkstreinenwiesiesowireineinbauseitkannimmertreppenliftmankeinvergleichenbeipreis

Longtail Keyword Density for Treppenlift-magazin.de

KeywordsOccurences
wird der treppenlift4
hohemarkstr 10-12 614403
10-12 61440 oberursel3
auf den5
fr einen5
der treppenlift5
der treppe4
wird der4
fr eine4
menschen die3
dies hngt3
1 13
die preise3
von treppenliften3
hohemarkstr 10-123
ist der3
der anbieter3
10-12 614403
von der3
zuschuss der3
gebrauchte treppenlifte3
61440 oberursel3
aber auch3
der47
die25
fr22
ist21
treppenlift21
euro21
den18
werden14
treppe12
sich11
auch11
sitzlift11
einen11
mit10
von10
auf10
dem10
eine10
nicht9
es9
mehr9
kosten9
preise9
treppenlifte9
nur8
kann7
menschen7
zu7
dies7
diese7
bei6
so6
im6
keine6
anbieter6
mglich5
sind5
05
durch5
ber5
plattformlift5
sie5
wird5
wie5
zuschuss5
muss5
als4
hngt4
man4
eines4
treppenliften4
ein4
preis4
zusammen4
06171-20616604
vergleichen4
frderung4
hublift4
seit4
das4
leben4
einem4
festpreis3
dass3
10-123
13
da3
bietet3
immer3
oberursel3
nach3
wandmontage3
infotreppenlift-magazinde3
wir3
23
seite3
zum3
aber3
oder3
gebrauchte3
treppensteigen3
hohemarkstr3
meist3
zur3
treppen3
bis3
zudem3
kein3
gerade3
einbau3
sehr3
gibt3
weiter3
vom3
des3
er3
kauf3
var3

What are the nameservers for treppenlift-magazin.de?

Treppenlift-magazin.de Domain Nameserver Information

HostIP AddressCountry
ns.inwx.de 192.174.68.104Austria Austria
ns2.inwx.de 176.97.158.104Austria Austria
ns3.inwx.eu 46.165.212.97Germany Germany
ns4.inwx.com 95.211.1.145Netherlands Netherlands
ns5.inwx.net 108.59.8.65United States United States

Treppenlift-magazin.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Treppenlift-magazin.de is a scam?