Homepage - Tuacahn Center for the Arts

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: 408,300
Estimated Worth: $10,440



Domain summary

Last updated
2021-09-26
Domain label
tuacahn
Domain extension
org
Domain registered:
2000-12-01
Domain updated:
2021-09-26
Global Traffic Rank
408,300
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$10,440
Estimated daily income
$29
Estimated monthly income
$882

Frequently Asked Questions (FAQ)

Q: When was Tuacahn.org registered?
A: Tuacahn.org was registered 20 years, 10 months, 2 weeks, 1 day, 2 hours, 43 minutes, 56 seconds ago on Friday, December 1, 2000.
Q: When was the WHOIS for Tuacahn.org last updated?
A: The WHOIS entry was last updated 2 weeks, 6 days, 2 hours, 43 minutes, 56 seconds ago on Sunday, September 26, 2021.
Q: What are Tuacahn.org's nameservers?
A: DNS for Tuacahn.org is provided by the following nameservers:
  • brit.ns.cloudflare.com
  • trey.ns.cloudflare.com
Q: Who is the registrar for the Tuacahn.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Tuacahn.org?
A: Tuacahn.org ranks 408,300 globally on Alexa. Tuacahn.org has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Tuacahn.org each day?
A: Tuacahn.org receives approximately 3,233 visitors and 9,699 page impressions per day.
Q: What IP address does Tuacahn.org resolve to?
A: Tuacahn.org resolves to the IPv4 address 141.193.213.20.
Q: In what country are Tuacahn.org servers located in?
A: Tuacahn.org has servers located in the United States.
Q: What webserver software does Tuacahn.org use?
A: Tuacahn.org is powered by CloudFlare webserver.
Q: Who hosts Tuacahn.org?
A: Tuacahn.org is hosted by Fujitsu Invia Finland IP-network in United States.
Q: How much is Tuacahn.org worth?
A: Tuacahn.org has an estimated worth of $10,440. An average daily income of approximately $29, which is roughly $882 per month.

Tuacahn.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Tuacahn.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Tuacahn.org

H1 Headings

40 :
  1. Enhanced Health And Safety
  2. Enhanced Health And Safety
  3. 2021 Concerts/Events
  4. MAY 7 - OCT 23, 2021
  5. CLOSED JUL 10, 2021
  6. JUL 17 - OCT 22, 2021
  7. JUL 24 - OCT 21, 2021
  8. Closed AUG 7, 2021
  9. NOV 26 - DEC 22, 2021
  10. 25 seasons
  11. 25 seasons
  12. 2020 Broadway Season Postponed
  13. 2020 Broadway Season Postponed
  14. Tuacahn 25th Anniversary Keepsake BundleAvailable now!
  15. 25 Seasons of Bringing Stories to Life
  16. The Music Man - 2000
  17. The Unsinkable Molly Brown - 2003
  18. Singin' in the Rain - 2004
  19. Disney's Beauty & the Beast - 2005
  20. My Fair Lady - 2007
  21. Big River - 2008
  22. Crazy for You - 2010
  23. Disney's Aladdin - 2012
  24. Cats - 2006
  25. Footloose - 2009
  26. Grease - 2011
  27. Joseph and the Amazing Technicolor Dreamcoat - 2002
  28. Joseph and the Amazing Technicolor Dreamcoat - 1999
  29. Disney's The Little Mermaid - 2014
  30. Disney's Mary Poppins - 2013
  31. Disney's Newsies - 2017
  32. Peter Pan - 2016
  33. The Prince of Egypt - 2018
  34. Sister Act - 2015
  35. The Sound of Music - 2001
  36. Utah! - 1997
  37. Utah! - 1995
  38. Utah! - 1996
  39. Utah - 1998
  40. The Sound of Music - 2019

H2 Headings

25 :
  1. Thriller
  2. Thriller
  3. Martina McBride
  4. Martina McBride
  5. Kansas
  6. Kansas
  7. Kristin Chenoweth
  8. Kristin Chenoweth
  9. Journey Unauthorized
  10. Journey Unauthorized
  11. Ryan Hamilton
  12. Ryan Hamilton
  13. Gentri – The Gentlemen Trio
  14. Gentri – The Gentlemen Trio
  15. Jenny Oaks Baker & Family Four
  16. Jenny Oaks Baker & Family Four
  17. 2021 Season Info Coming Soon
  18. Beauty & the Beast
  19. Beauty & the Beast
  20. The Count of Monte Cristo
  21. The Count of Monte Cristo
  22. Annie
  23. Annie
  24. Smokey Joe's Cafe
  25. Smokey Joe's Cafe

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

57 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

129:

Links - Outbound

6:

Links - Outbound (nofollow)

3:

Keyword Cloud for Tuacahn.org

bakeramphitheatre more infowindowonload functioncoming summer 2021else iflinktype seatselectpostponedinfo nov175 20212021 tuacahn amphitheatre4 2021falseoctspacebetween 20 102430 2021returnclickiflinkurivaluelinktype7disneyspushpromocodevar9gailvar urisswiperpaginationpaginationnovlearn more038 familynewnavigation nexteliflinktype mapselect linksihrefsummer 2021 outdoordocumentreadystateelse iflinktypewindowonloadticketsserverassignmentyouajaxtrueoutdoorloadingmontecredittuacahn amphitheatrehyrumnavigationajaxrevslidersummer 2021miscitemoutdoor amphitheatre morerscustomajaxcontentloadingfunction20 1024iflinktype mapselectgentlemenmusicinfo actor credit03814true navigation nextelslidesperviewmore info postponedlearnswiperbuttonnext prevel swiperbuttonprevseatselectlinksihref linksihrefspacebetween8tuacahn amphitheatre morecreditsiflinktype seatselect linksihrefifpageurivalue falselinkurivalue twpavcgeturlvarslinksihrefc0 linktypefalse linkurivalueiflinktypewe4oaksseatselect linksihref26 30julinfosound of musicmslsmithel swiperpagination clickable16ifticketsserverassignmentvalue25 seasonsswiperpagination clickablesummerhafencontainerifurislengthpolicyseatselect linksihref linksihref13pageurivalue twpavcgeturlvarswindowlocationhref11 2021novembertwpavcgeturlvarslinksihrefoutdoor amphitheatreelse linksihref linksihrefcoming summermiscitem linksihrefdefault vartrue navigationmore infoticketsserverassignmentvaluedefaultactor crediturisindoorbreakpointspagination el swiperpaginationifurislength 0castnextelprevelclickable trueamphitheatremapselect linksihref linksihrefrscustomajaxcontentonceutahamphitheatre 2021stokencount of monteiffalse varifavsessionkeyvalue2021 tuacahnlinkurivalueoaks baker 038nulliflinktype miscitem linksihrefswiperbuttonnextpageurivalueelse iflinktype miscitemdefault var msl10uris twpavcgeturlvarslinksihrefmapselectfalse linkurivalue twpavcgeturlvarslinksihref12debuggerfunctionamazingel swiperpagination220 2021navigation nextel swiperbuttonnext155info actor credits2021 outdoor11nextel swiperbuttonnextiflinkurivalue false linkurivalueseason postponedtheatre0more6 2021actorposttuacahn castavsessionkeyvalueiflinktype seatselect6countbeauty the beasttypelinksihrefuseifmsl 0 linktype2021 outdoor amphitheatreelsecontenttuacahnbeautymore info novmapselect linksihrefifmslfamilymiscitem linksihref linksihref3else linksihrefspacebetween 20dataactor creditsbaker 038 familybreakpoints 320false var urisswiperbuttonnext prevelamphitheatre morekeepsakenextel swiperbuttonnext prevelseasonbeastiflinkurivalue falsesoundinfo postponedel26 30 2021var uris twpavcgeturlvarslinksihrefprevel swiperbuttonprevswiperbuttonprev12 2021pageuristoragevaluemore info actor13 20211varclickableindoor hafeninfo actorcomingoaks bakervar mslswiperpagination clickable trueifpageurivaluetwpavcgeturlvarswindowlocationhrefiflinktype miscitemifmsl 0ajax contentbroadwaybaker 038pagination elseasons

Longtail Keyword Density for Tuacahn.org

KeywordsOccurences
more info actor23
amphitheatre more info22
info actor credits18
tuacahn amphitheatre more16
2021 tuacahn amphitheatre16
more info nov7
outdoor amphitheatre more6
iflinkurivalue false linkurivalue6
false linkurivalue twpavcgeturlvarslinksihref6
info actor credit5
else linksihref linksihref5
mapselect linksihref linksihref4
else iflinktype seatselect4
iflinktype seatselect linksihref4
seatselect linksihref linksihref4
else iflinktype miscitem4
iflinktype miscitem linksihref4
miscitem linksihref linksihref4
iflinktype mapselect linksihref4
var uris twpavcgeturlvarslinksihref3
false var uris3
ifmsl 0 linktype3
default var msl3
sound of music3
26 30 20213
count of monte3
2021 outdoor amphitheatre3
summer 2021 outdoor3
coming summer 20213
beauty the beast3
spacebetween 20 10243
swiper-button-next prevel swiper-button-prev3
nextel swiper-button-next prevel3
navigation nextel swiper-button-next3
true navigation nextel3
swiper-pagination clickable true3
el swiper-pagination clickable3
pagination el swiper-pagination3
baker 038 family3
oaks baker 0383
more info postponed3
more info49
info actor23
amphitheatre more22
tuacahn amphitheatre18
actor credits18
linksihref linksihref18
2021 tuacahn16
spacebetween 2010
else iflinktype10
tuacahn cast10
linkurivalue twpavcgeturlvarslinksihref7
iflinkurivalue false7
outdoor amphitheatre7
info nov7
false linkurivalue6
false var6
ifpageurivalue false5
actor credit5
else linksihref5
iflinktype mapselect4
var uris4
miscitem linksihref4
iflinktype miscitem4
seatselect linksihref4
iflinktype seatselect4
mapselect linksihref4
ajax content3
indoor hafen3
pageurivalue twpavcgeturlvarswindowlocationhref3
ifurislength 03
default var3
var msl3
ifmsl 03
0 linktype3
uris twpavcgeturlvarslinksihref3
25 seasons3
learn more3
info postponed3
el swiper-pagination3
30 20213
4 20213
5 20213
6 20213
11 20213
12 20213
13 20213
oaks baker3
baker 0383
038 family3
20 20213
pagination el3
swiper-pagination clickable3
2021 outdoor3
clickable true3
true navigation3
navigation nextel3
nextel swiper-button-next3
swiper-button-next prevel3
prevel swiper-button-prev3
breakpoints 3203
20 10243
windowonload function3
amphitheatre 20213
26 303
coming summer3
summer 20213
season postponed3
more52
info50
041
linksihref37
tuacahn35
var30
amphitheatre25
actor23
else21
false20
credits18
function16
iflinktype14
november14
113
true13
spacebetween12
cast12
twpavcgeturlvarslinksihref11
content10
utah9
ajax9
29
linkurivalue8
nov8
postponed7
if7
season7
outdoor7
iflinkurivalue7
coming6
type6
pageurivalue6
oct6
debugger5
null5
35
disneys5
credit5
45
return5
we5
avsessionkeyvalue5
pushpromocodevar5
jul5
seatselect5
miscitem5
family5
ifpageurivalue5
broadway5
slidesperview5
mapselect5
uris4
post4
you4
twpavcgeturlvarswindowlocationhref4
54
music4
use4
hyrum4
gail4
64
linktype4
beauty4
default4
summer4
rscustomajaxcontentonce4
data3
ifavsessionkeyvalue3
msl3
ticketsserverassignment3
ticketsserverassignmentvalue3
documentreadystate3
ifticketsserverassignmentvalue3
pageuristoragevalue3
container3
ifurislength3
stoken3
ifmsl3
loading3
click3
keepsake3
rscustomajaxcontentloadingfunction3
pagination3
prevel3
swiper-button-next3
nextel3
navigation3
clickable3
swiper-pagination3
el3
new3
breakpoints3
0383
baker3
oaks3
73
gentlemen3
83
93
103
swiper-button-prev3
113
ajaxrevslider3
theatre3
123
policy3
sound3
amazing3
smith3
learn3
seasons3
133
hafen3
143
indoor3
monte3
count3
153
beast3
163
windowonload3
173
c3

Who hosts Tuacahn.org?

Tuacahn.org Hosting Provider Information

Hosted IP Address:141.193.213.20
Hosted Hostname:141.193.213.20
Service Provider:Fujitsu Invia Finland IP-network
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "Fujitsu Invia Finland IP-network" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
Fujitsu Invia Finland IP-network
0.0067%

HTTP Header Analysis for Tuacahn.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 26 Sep 2021 19:36:42 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding,Cookie
Link:; rel=shortlink
X-TEC-API-VERSION: v1
X-TEC-API-ROOT: https://www.tuacahn.org/wp-json/tribe/events/v1/
X-TEC-API-ORIGIN: https://www.tuacahn.org
X-Powered-By: WP Engine
X-Cacheable: SHORT
Cache-Control: max-age=600, must-revalidate
X-Cache: HIT: 9
X-Cache-Group: normal
Strict-Transport-Security: max-age=31536000; includeSubDomains; preload
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 694ef15199cd06e1-LHR
Content-Encoding: gzip
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400, h3-28=":443"; ma=86400, h3-27=":443"; ma=86400

Tuacahn.org Domain Nameserver Information

HostIP AddressCountry
brit.ns.cloudflare.com 173.245.58.78
trey.ns.cloudflare.com 108.162.193.242


Need to find out who hosts Tuacahn.org?


Domain Registration (WhoIs) information for Tuacahn.org

 Domain Name: TUACAHN.ORG
Registry Domain ID: D17302227-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2019-06-16T10:32:04Z
Creation Date: 2000-01-12T03:28:31Z
Registry Expiry Date: 2022-01-12T03:28:31Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Tuacahn Center for the Arts
Registrant State/Province: UT
Registrant Country: US
Name Server: BRIT.NS.CLOUDFLARE.COM
Name Server: TREY.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-07T18:03:48Z

Websites with Similar Names

Tuaca.com
Tuaca, and then...
Tuaca.us
Tuaca, and then...
Tuaca.xyz
tuaca.xyz - Registered at Namecheap.com
Tuacademia.co
tuacademia.co
Tuacademiadeingles.com
Error 404 (Not Found)!!1
Tuacademiaencasa.com
Tu Academia en Casa – Aprende inglés desde la comodidad de tu casa.
Tuacademiaenlaweb.com
TU.Academy - Tu academia en la web
Tuacademiaenmadrid.com
Centro de Estudios Luis Vives Sol - Más de 20 años de experiencia

Recently Updated Websites

Timmscentre.ca (3 seconds ago.)Narlah.com (4 seconds ago.)Gumbothebarista.com (5 seconds ago.)Gocovri-hcp.net (5 seconds ago.)Chelyabinsk.press (7 seconds ago.)Firstchaircarpentry.com (8 seconds ago.)Wikimebe.net (9 seconds ago.)Kantorei.ch (10 seconds ago.)Lesbijouxdeghislaine.com (11 seconds ago.)Altafsanjna.com (15 seconds ago.)Awaiver.com (16 seconds ago.)Chemistryscl.com (16 seconds ago.)Anestesitjeneste.org (17 seconds ago.)Donwagnerca.com (20 seconds ago.)Ebsss.com (21 seconds ago.)Trumpisinsane.com (22 seconds ago.)Shotfacedonice.com (25 seconds ago.)Titanmachinery.ua (26 seconds ago.)Livehealthywithpatty.com (27 seconds ago.)Chelsylyn.com (29 seconds ago.)Agricannture.com (29 seconds ago.)Huntermcgarry.com (31 seconds ago.)Netpixeltech.com (32 seconds ago.)Theremincinema.com (33 seconds ago.)Dfmhealth.com (35 seconds ago.)Friendly-savyonim.co.il (35 seconds ago.)Promoeaso.net (36 seconds ago.)Inesmocho.online (36 seconds ago.)Blayzair.com (37 seconds ago.)Newageinternationaltraining.com (39 seconds ago.)

Recently Searched Keywords

earlier than 72 (1 second ago.)dates vary (1 second ago.)mysbu (1 second ago.)data-hookvideo-list-thumb-wrapperdata-thumbnail-min-width400px 1gvix (2 seconds ago.)data analysis excel 2013 (3 seconds ago.)самолёты (4 seconds ago.)twist quotjeremyx27s closetquot (4 seconds ago.)cis group (4 seconds ago.)contenido (5 seconds ago.)电热消解仪 (6 seconds ago.)cookievalueprefix (7 seconds ago.)uumlst goumlvdesi (8 seconds ago.)yamakasi (8 seconds ago.)renkl tali (9 seconds ago.)cis group jobs (10 seconds ago.)logstash (10 seconds ago.)挂号信签收 (12 seconds ago.)pl-219 panel-grid (12 seconds ago.)bhoot ki kahani (13 seconds ago.)file ensure (13 seconds ago.)mdr aktuell rss feed (14 seconds ago.)free amp templates (14 seconds ago.)bsqueda para (15 seconds ago.)w3index (15 seconds ago.)next month but (16 seconds ago.)schreiben (16 seconds ago.)carabao cup final (16 seconds ago.)4:58 pm (16 seconds ago.)boohooman usa (17 seconds ago.)beluga signature (17 seconds ago.)