Turkiye.gov.tr  |  Anasayfa - Devletin K?sayolu | www.türkiye.gov.tr
Low trust score  | 
e-Devlet Kap?s?'n? kullanarak kamu kurumlar?n?n sundu?u hizmetlere tek noktadan, h?zl? ve güvenli bir ?ekilde ula?abilirsiniz.

Turkiye.gov.tr Website Information

Turkiye.gov.tr has a Low Trust Score, a Statvoo Rank of D, an Alexa Rank of 2,022, a Majestic Rank of 52,124, a Domain Authority of 69% and is not listed in DMOZ.

Turkiye.gov.tr is hosted by Turksat Uydu Haberlesme ve Kablo TV Isletme A.S. in Ankara, Ankara, Turkey, 12800.
Turkiye.gov.tr has an IP Address of 94.55.118.33 and a hostname of www.turkiye.gov.tr.

The domain turkiye.gov.tr was registered 201 decades 9 years 15 hours ago by , it was last modified 201 decades 9 years 15 hours ago and currently is set to expire 201 decades 9 years 15 hours ago.


Who hosts Turkiye.gov.tr?

Turkiye.gov.tr Web Server Information

Hosted IP Address:94.55.118.33
Hosted Hostname:www.turkiye.gov.tr
Service Provider:Turksat Uydu Haberlesme ve Kablo TV Isletme A.S.
Hosted Country:TurkeyTR
Location Latitude:39.9199
Location Longitude:32.8543
Webserver Software:Not Applicable

HTTP Header Analysis for Turkiye.gov.tr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 09 Jun 2015 00:07:48 GMT
Content-Type: text/html; charset=UTF-8
Connection: close
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache


Need to find out who hosts Turkiye.gov.tr?

Turkiye.gov.tr Free SEO Report

Website Inpage Analysis for Turkiye.gov.tr

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Turkiye.gov.tr

sorgulamavukuatl nfus kaytedevlet kapsartkbakanlkapsyapabilirsinizhizmethzlsymnfusyardmgirihizmetlerevukuatl nfusveiingvenlikekaytedevletsayfakaps039ndanyenitmulaabilirsinizbuvukuatlkaythizmetlerigeneledevlet kaps039ndankurumlarbilgikamuhizmetlerehizmetlernfus kaytbavurusuilesosyalyurtokeriilebilirlikana

Longtail Keyword Density for Turkiye.gov.tr

KeywordsOccurences
vukuatl nfus kayt3
e-devlet kaps3
nfus kayt3
vukuatl nfus3
e-devlet kaps039ndan3
ve16
e-devlet12
tm6
hizmet6
ile5
genel5
sorgulama5
gvenlik5
kurumlar5
kayt5
iin4
hizmetleri4
kamu4
bu4
bavurusu4
hizmetler4
bilgi3
ulaabilirsiniz3
kaps3
sym3
hzl3
ok3
yeni3
artk3
bakanl3
hizmetlere3
nfus3
yurt3
yapabilirsiniz3
yardm3
sosyal3
e-hizmetler3
giri3
eriilebilirlik3
vukuatl3
kaps039ndan3
sayfa3
e-kayt3
ana3

What are the nameservers for turkiye.gov.tr?

Turkiye.gov.tr Domain Nameserver Information

HostIP AddressCountry
ns2.turkiye.gov.tr 94.55.118.8Turkey Turkey
ns1.turkiye.gov.tr 94.55.117.7Turkey Turkey

Turkiye.gov.tr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Turkiye.gov.tr is a scam?