Twowheel.co.uk  |  Two Wheel Centre - RST Clothing | Sidi Boots | AGV Helmets | Shoei Helmets
Low trust score  | 
Free UK delivery. Finance available. Two Wheel Centre are official stockists of RST clothing, Sidi boots, AGV helmets, Shoei helmets and more. Everything for you and your motorcycle! We are agents for Peugeot, Vespa, Gilera, Piaggio and Lambretta 50cc and 125cc scooters.

Twowheel.co.uk Website Information

Twowheel.co.uk has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 571,382, a Majestic Rank of 772,253, a Domain Authority of 24% and is not listed in DMOZ.

Twowheel.co.uk is hosted by Simply Transit Ltd in England, Maidenhead, United Kingdom, Sl6 1jf.
Twowheel.co.uk has an IP Address of 158.255.43.96 and a hostname of 158.255.43.96.

The domain twowheel.co.uk was registered 1 decade 8 years 8 months ago by , it was last modified 4 years 4 months 5 days ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for twowheel.co.uk

Full Whois Lookup for Twowheel.co.uk Whois Lookup

Domain name:
twowheel.co.uk

Registrant:
Mr Peter Scott

Registrant type:
UK Limited Company, (Company number: 6572109)

Registrant's address:
1-5 Priory Square
Mansfield Woodhouse
Mansfield
Nottinghamshire
NG19 9LN
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 09-Oct-2015

Registrar:
Fasthosts Internet Ltd [Tag = LIVEDOMAINS]
URL: http://www.fasthosts.co.uk

Relevant dates:
Registered on: 08-Nov-2000
Expiry date: 08-Nov-2017
Last updated: 09-Oct-2016

Registration status:
Registered until expiry date.

Name servers:
ns2.thisiskode.com
ns3.thisiskode.com

WHOIS lookup made at 08:32:36 13-Sep-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Twowheel.co.uk?

Twowheel.co.uk Web Server Information

Hosted IP Address:158.255.43.96
Hosted Hostname:158.255.43.96
Service Provider:Simply Transit Ltd
Hosted Country:United KingdomGB
Location Latitude:51.5228
Location Longitude:-0.71986
Webserver Software:Not Applicable

HTTP Header Analysis for Twowheel.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 08 Sep 2015 10:20:23 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PleskLin
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Expires: -1
Last-Modified: Tue, 08 Sep 2015 10:20:23 GMT
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip


Need to find out who hosts Twowheel.co.uk?

Twowheel.co.uk Free SEO Report

Website Inpage Analysis for Twowheel.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Twowheel.co.uk

tractechyellowsuitsmightothervaluejacketview all ourfield fieldbasketnorangefield is invalidtwo wheel centreairalongsidemore sepmotorcycle bootsallsystemscash backrsaquonbspread moretractech evorichaservicegenuinenowvalue myrst clothingfittingxfree ukyou might alsonew suzukiclothing rangetyghclothingpartsused bikesbacksep1rstmoto gp oxfordheatedbikenewqualitycentrecarevalue my bikeviewsidi spadahave0matchrsaquonbspread more seppro seriesyoufinancehelmetsmoresuzukiquotetucano urbano vespacurrentmotorcycle trainingsidi bootshelmet016235pleaseservicingtucano urbanoweisealsobikesgpknox6suzuki genuine accessoriesrst pro serieswheeldelivereverydaygsxrsidiagvpricemerlin4ukricha rstmostbasket is emptysummercash back offeroneventedtucanowinterlookingridingordersmight also likeback offeralso likeall ourboxheated glovesfunctionurbano vespavespayour bikemotorcycle jacketsbuffalopromotorbike glovestrainingyou mightif you2 jacketrst procashfreemy bikeshoeiproductstwo wheelmotorcycleifjeansstockhjcmotorcycle brandsrsaquonbspreadrsaquonew bikesnottinghamshirerange of rstwaterprooftextilemight alsoagv k3errornot1000ccconditionsview allussvrst tractechk3k3 svmotorcycle clothingyouremailstylecurrent rangeinvalidmyurbano3offersouralpinestarsupnottinghamincludingracedoagv k3 svtyresbrandsallweathermoto2motorbikeampdiscountgerbingusedwe stockoversportsfieldlinkscandesignedemptyriderhandssoitemslikecaberggiftsselectedweise clothingunbeatableuk deliverywheel centreladieswe canbrands alpinestarsbrowseclearancemoto gpevoleatherbrandfindsuzuki genuineoffermansfieldpiaggiomotorcyclesrst tractech evofree uk deliveryaccessoriesblackadventuretypesspadaglovestwocomeoxfordbootsgp oxfordwesomethingtrousersgenuine accessoriesdeliveryseriespricesluggageprotectionbeenjackets

Longtail Keyword Density for Twowheel.co.uk

KeywordsOccurences
might also like9
you might also9
view all our6
two wheel centre6
rst pro series4
field is invalid4
basket is empty4
cash back offer4
value my bike3
range of rst3
free uk delivery3
rsaquonbspread more sep3
agv k3 sv3
moto gp oxford3
rst tractech evo3
suzuki genuine accessories3
tucano urbano vespa3
might also9
also like9
you might9
all our8
two wheel8
field field7
tucano urbano7
wheel centre6
view all6
k3 sv4
free uk4
brands alpinestars4
tractech evo4
rst pro4
rsaquonbspread more4
pro series4
back offer4
heated gloves4
cash back4
sidi boots3
current range3
rst clothing3
your bike3
we can3
new bikes3
new suzuki3
clothing range3
2 jacket3
motorcycle training3
uk delivery3
we stock3
motorbike gloves3
motorcycle jackets3
weise clothing3
used bikes3
more sep3
motorcycle boots3
urbano vespa3
sidi spada3
richa rst3
moto gp3
gp oxford3
rst tractech3
genuine accessories3
if you3
value my3
my bike3
agv k33
suzuki genuine3
motorcycle brands3
motorcycle clothing3
boots31
motorcycle31
you29
rst27
gloves25
range22
our19
suzuki19
your19
clothing19
new18
sidi18
helmets17
all17
jacket16
agv16
rsaquo15
field14
also14
bike14
bikes13
we12
have12
brands12
accessories11
jackets11
training11
weise11
like10
clearance9
might9
wheel9
more9
two9
view8
including8
motorbike8
offer8
empty8
not8
08
protection8
17
tucano7
hjc7
urbano7
over7
alpinestars7
can6
if6
centre6
so6
heated6
ladies6
richa6
basket6
free6
spada6
value6
parts6
my6
selected5
orders5
trousers5
gerbing5
oxford5
riding5
waterproof5
leather5
black5
air5
uk5
back5
25
invalid5
used5
race5
34
tractech4
k34
please4
sv4
all-weather4
pro4
evo4
amp4
email4
quality4
series4
prices4
nottinghamshire4
function4
current4
nottingham4
servicing4
rsaquonbspread4
sep4
find4
mansfield4
do4
us4
shoei4
alongside4
items4
adventure4
other4
knox4
gp4
price4
textile4
helmet4
cash4
vespa4
piaggio4
tygh4
types4
hands4
no4
browse4
delivery4
service4
been4
up4
1000cc4
x3
deliver3
designed3
brand3
unbeatable3
offers3
one3
looking3
everyday3
products3
stock3
links3
conditions3
vented3
style3
error3
rider3
quote3
genuine3
moto3
finance3
sports3
winter3
summer3
merlin3
buffalo3
systems3
care3
caberg3
box3
jeans3
suits3
43
gifts3
tyres3
gsxr3
now3
most3
something3
016233
fitting3
yellow3
match3
luggage3
discount3
motorcycles3
53
63
come3

What are the nameservers for twowheel.co.uk?

Twowheel.co.uk Domain Nameserver Information

HostIP AddressCountry
ns2.thisiskode.com 158.255.43.98United Kingdom United Kingdom
ns3.thisiskode.com 158.255.43.98United Kingdom United Kingdom

Twowheel.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Twowheel.co.uk is a scam?