Tyndallfcu.org Website Analysis Summary

Tyndallfcu.org  |  Tyndall | Mortgage Lending, Auto Loans, Home Equity Loans, Member Checking, Member Savings, Banking Accounts, Tyndall Trader, Credit Union Loan Rates, Tyndall Branches, Tyndall Online Banking, Tyndall Visa® Credit Cards, Tyndall ScoreCard® Program
Low trust score  | 
Tyndall | Home


Rank
4,457,815
Rating
I
Trust Score
Low Trust Score
Estimated worth
$240
Estimated daily income
$1
Estimated monthly income
$30
Backlinks
0

Tyndallfcu.org has a Low Trust Score, and a Statvoo Rank of I.

Tyndallfcu.org is hosted by Hostway Services, Inc. in Texas, Austin, United States, 78702.
Tyndallfcu.org has an IP Address of 216.139.234.21 and a hostname of mail2.coursetrends.com.

The domain tyndallfcu.org was registered 2 decades 3 years 11 months ago by , it was last modified 201 decades 9 years 3 months ago and currently is set to expire 201 decades 9 years 3 months ago.

It is the world's 4,457,815 most popular site among over 300 million websites.

Tyndallfcu.org has a total of 0 backlinks.

Tyndallfcu.org gets approximately 108 unique visitors a day and 394 pageviews per day.

Tyndallfcu.org has an estimated worth of $240.
An average daily income of approximately $1, which is wroughly $30 per month.

Whois information for tyndallfcu.org

Full Whois Lookup for Tyndallfcu.org Whois Lookup

Domain Name: TYNDALLFCU.ORG
Registry Domain ID: D4478725-LROR
Registrar WHOIS Server:
Registrar URL: http://www.directnic.com
Updated Date: 2016-09-29T20:07:55Z
Creation Date: 1996-02-15T05:00:00Z
Registry Expiry Date: 2018-02-16T05:00:00Z
Registrar Registration Expiration Date:
Registrar: DNC Holdings, Inc.
Registrar IANA ID: 291
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C183376351-LROR
Registrant Name: Lisa Warnick
Registrant Organization: Tyndall Federal Credit Union
Registrant Street: P.O. Box 59760
Registrant City: Panama City
Registrant State/Province: FL
Registrant Postal Code: 32412-0760
Registrant Country: US
Registrant Phone: +1.8507699999
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C183376351-LROR
Admin Name: Lisa Warnick
Admin Organization: Tyndall Federal Credit Union
Admin Street: P.O. Box 59760
Admin City: Panama City
Admin State/Province: FL
Admin Postal Code: 32412-0760
Admin Country: US
Admin Phone: +1.8507699999
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C149276871-LROR
Tech Name: Bob Dooley
Tech Organization: Tyndall Federal Credit Union
Tech Street: 3109 Minnesota Avenue
Tech City: Panama City
Tech State/Province: FL
Tech Postal Code: 32405
Tech Country: US
Tech Phone: +1.8033456880
Tech Phone Ext:
Tech Fax: +1.8033456880
Tech Fax Ext:
Tech Email: Login to show email
Server: NS10.DNSMADEEASY.COM
Name Server: NS11.DNSMADEEASY.COM
Name Server: NS12.DNSMADEEASY.COM
Name Server: NS13.DNSMADEEASY.COM
Name Server: NS14.DNSMADEEASY.COM
Name Server: NS15.DNSMADEEASY.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-18T13:30:15Z

Who hosts Tyndallfcu.org?

Tyndallfcu.org Web Server Information

Hosted IP Address:216.139.234.21
Hosted Hostname:mail2.coursetrends.com
Service Provider:Hostway Services, Inc.
Hosted Country:United StatesUS
Location Latitude:30.2643
Location Longitude:-97.7139
Webserver Software:Not Applicable

HTTP Header Analysis for Tyndallfcu.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 25 May 2015 06:18:07 GMT
Server: Apache/2.2.22 (Ubuntu)
X-Runtime: 32
ETag: "9775d073e3955e4de95c40cdd357c510"
Cache-Control: private, max-age=0, must-revalidate
X-Powered-By: Phusion Passenger 4.0.25
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 9515
Content-Type: text/html; charset=utf-8

Need to find out who hosts Tyndallfcu.org?

Tyndallfcu.org Free SEO Report

Website Inpage Analysis for Tyndallfcu.org

H1 Headings:1
0
H2 Headings:1
0
H3 Headings:1
0
H4 Headings:1
4
H5 Headings:1
3
H6 Headings:1
0
Total IFRAMEs:1
Total Images:21
Google Adsense:Not Applicable
Google Analytics:UA-22661745-37

Keyword Cloud for Tyndallfcu.org

online banking loginmain streetmembershipotheraccounttollfreefinancialforgot password newchangedebitbanking logintel1html8507699999gmt path varoverdraftpassword forgot passwordratesmobile branchfl 32405makelowthomasbrowserdrive branchprotectiondec 9999 235959documentcookiereplacesclatss 1 varstaddress2textpanama city fllogfort blvdparkwaytel20html8507699999 tel21html8888963255 tollfreeifclosestlon1feeformsaccountsindexfunctionindex2federalbranch panama cityid password forgotpassword newchangelocationmodalhide localbranchmodalhidewestway branchloan ratesdfort aluser idtel20html8507699999 tel21html8888963255faqsloginhome9999 235959 gmtst branchlocalbranchmodalhidepanamascityviewdrivecalldirect depositnowbranches amp1235959 gmt pathhome equityiftypenohavenloansexpiresfrirdforce base branchclngnotequitycity flcity beach branchforgotdocumentcookiereplacesclatssmaplat8employmentgmt pathfederal creditjoe flnews amp noticesexpiresfri 31 deccity 23rd st4tyndall federaladdress21textpanama cityforce base flservicecorner branchjoepanama city flyoulocalbranchmodalhide changelocationbghidepath3expiresfri 31home equity loans9999 23595931 dec 9999haven fladdress21textpanamafort al 36527tel2html8888963255noticesjoe branch23rd stcorneruniondepositlocationcomponentshortnamemindifbranch panamamobileairlocalnavigationst joe branchnew user logdocumentcookiereplacesclatss 1tel1html8507699999 tel2html8888963255changelocationmodalhidenew userinstitutionxwestwaybankinglongitudedocumentcookiereplacesclngssidforce basepassworduser id passwordyourauto loanstel21html8888963255 tollfree ifclosestcontact usst joespanish fortpanama citycardsal 36527lnguscommatextinsurance0branches amp atmsbeach branchuserbase flserviceschangelocationbghidemainequity loanshaven branchcheckingflsite1 varamp noticesdocumentreadyfunctionweb sitelendingchecking accountsiflat2password new usercontactmoredocumentcookietel1html8507699999 tel2html8888963255 tollfreeforgot passwordamp atmscity beach fldecscheduleoverdraft protectiontel20html8507699999tyndall federal credittollfree ifclosestdec 9999changelocationmodalhide localbranchmodalhide changelocationbghidelon2memberaleveryday bankingstatethird partycity 23rd23rdlearn moreminnesotaourdirectstatusaddress2textpanama cityair force basepath vargmtid passwordlinks6informationonline bankingcity fl 32405city and statenewscredit cardsregioncodehtmlstatetel21html8888963255federal credit unionpanama city beach31 decmapoptions235959 gmtbranchblvdtruemylngnews ampspanish fort blvdpartyst joe flspanishautosavingsmymapaddresscredit unionpassword forgotcenterprivacyampmortgagemaplonsecuritybeachfortbranchesair forcefunctionforcebaseimagefort branchvarnewstate varview localtel2html8888963255 tollfreecity beachtel21html8888963255 tollfreeeverydayuser logaddress21textpanama city fl23rd st branchcardatmsthirdcreditloan5tyndallwebbase branchstreet7learndifbeach flcityhtmlcityonlineincludingydocumentcookiereplacesclngss 1address2textpanamamylatlnglat

Longtail Keyword Density for Tyndallfcu.org

KeywordsOccurences
31 dec 999917
9999 235959 gmt17
235959 gmt path17
expiresfri 31 dec17
dec 9999 23595917
tel21html888-896-3255 toll-free ifclosest13
tel1html850-769-9999 tel2html888-896-3255 toll-free7
tel20html850-769-9999 tel21html888-896-3255 toll-free7
panama city fl6
air force base6
city beach fl5
federal credit union5
tyndall federal credit5
online banking login5
city fl 324055
news amp notices4
gmt path var4
panama city beach4
branch panama city4
city and state4
password forgot password4
id password forgot4
user id password4
password new user4
forgot password new4
new user log4
address21textpanama city fl3
st joe branch3
force base fl3
force base branch3
address2textpanama city fl3
branches amp atms3
fort al 365273
home equity loans3
change-location-modalhide local-branch-modalhide change-location-bghide3
spanish fort blvd3
documentcookiereplacesclatss 1 var3
city beach branch3
23rd st branch3
city 23rd st3
st joe fl3
9999 23595917
dec 999917
31 dec17
expiresfri 3117
235959 gmt17
gmt path17
tel21html888-896-3255 toll-free14
tel2html888-896-3255 toll-free14
toll-free ifclosest13
city fl12
credit union11
panama city11
city beach10
online banking9
tel1html850-769-9999 tel2html888-896-32557
tel20html850-769-9999 tel21html888-896-32557
1 var7
spanish fort7
home equity6
air force6
st joe6
force base6
beach fl5
credit cards5
federal credit5
tyndall federal5
fl 324055
address2textpanama city5
address21textpanama city5
web site5
banking login5
path var4
new user4
news amp4
amp notices4
main street4
view local4
contact us4
fort al4
fort branch4
user id4
id password4
forgot password4
branch panama4
user log4
password forgot4
password new4
st branch3
city 23rd3
23rd st3
base fl3
joe fl3
joe branch3
base branch3
drive branch3
beach branch3
local-branch-modalhide change-location-bghide3
checking accounts3
auto loans3
equity loans3
direct deposit3
al 365273
fort blvd3
loan rates3
branches amp3
amp atms3
everyday banking3
overdraft protection3
learn more3
westway branch3
mobile branch3
corner branch3
haven fl3
documentcookiereplacesclngss 13
documentcookiereplacesclatss 13
third party3
change-location-modalhide local-branch-modalhide3
state var3
haven branch3
var56
branch45
fl32
city32
toll-free29
credit21
017
gmt17
path17
117
documentcookie17
tyndall17
expiresfri17
dec17
217
banking15
tel2html888-896-325514
ifclosest14
tel21html888-896-325514
center13
al13
amp12
account12
loans12
function12
union11
new11
311
fort11
panama11
beach10
us9
mobile9
home9
online9
st9
loan8
information8
password8
member8
user8
cards8
rates7
equity7
services7
tel20html850-769-99997
if7
you7
spanish7
tel1html850-769-99997
state7
air6
site6
financial6
joe6
force6
46
street6
s6
our6
location6
web6
base6
haven6
notices6
atms6
55
login5
federal5
make5
23rd5
65
fee5
address2textpanama5
address21textpanama5
auto5
accounts5
blvd5
mymap5
news5
deposit5
longitude5
iftype5
lat4
maplat4
maplon4
lat24
mylatlng4
mapoptions4
cityhtmlcity4
local-branch-modalhide4
status4
functionindex4
not4
more4
d4
call4
x4
your4
image4
schedule4
mortgage4
other4
rd4
main4
index4
lending4
privacy4
true4
parkway4
contact4
no4
change4
view4
forgot4
local4
log4
id4
documentcookiereplacesclatss3
documentcookiereplacesclngss3
clng3
commatext3
corner3
westway3
lon23
thomas3
drive3
mindif3
y3
lon13
dif3
navigation3
overdraft3
direct3
card3
protection3
service3
browser3
forms3
membership3
debit3
faqs3
everyday3
employment3
branches3
73
checking3
insurance3
savings3
including3
now3
change-location-bghide3
change-location-modalhide3
minnesota3
lng3
componentshortname3
mylng3
regioncodehtmlstate3
address3
low3
documentreadyfunction3
learn3
institution3
third3
party3
security3
links3
83

What are the nameservers for tyndallfcu.org?

Tyndallfcu.org Domain Nameserver Information

HostIP AddressCountry
ns10.dnsmadeeasy.com 208.94.148.4United States United States
ns11.dnsmadeeasy.com 208.80.124.4United States United States
ns12.dnsmadeeasy.com 208.80.126.4United States United States
ns13.dnsmadeeasy.com 208.80.125.4United States United States
ns14.dnsmadeeasy.com 208.80.127.4United States United States
ns15.dnsmadeeasy.com 208.94.149.4United States United States

Tyndallfcu.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Tyndallfcu.org is a scam?