Typingjobs.org


Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-30
Category: This site has not been categorized yet


Domain summary

Domain label
typingjobs
Domain extension
org
Domain registered:
2019-12-03
Domain updated:
2020-10-30
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is typingjobs.org ranked relative to other sites:

Percentage of visits to typingjobs.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Typingjobs.org registered?
A: Typingjobs.org was registered 1 year, 1 day, 11 hours, 13 minutes, 26 seconds ago on Tuesday, December 3, 2019.
Q: When was the WHOIS for Typingjobs.org last updated?
A: The WHOIS entry was last updated 1 month, 5 days, 11 hours, 13 minutes, 26 seconds ago on Friday, October 30, 2020.
Q: What are Typingjobs.org's nameservers?
A: DNS for Typingjobs.org is provided by the following nameservers:
  • ns05.domaincontrol.com
  • ns06.domaincontrol.com
Q: Who is the registrar for the Typingjobs.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Typingjobs.org?
A: Typingjobs.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Typingjobs.org each day?
A: Typingjobs.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Typingjobs.org resolve to?
A: Typingjobs.org resolves to the IPv4 address 34.102.136.180.
Q: In what country are Typingjobs.org servers located in?
A: Typingjobs.org has servers located in the United States.
Q: What webserver software does Typingjobs.org use?
A: Typingjobs.org is powered by Openresty webserver.
Q: Who hosts Typingjobs.org?
A: Typingjobs.org is hosted by DoD Network Information Center in United States.
Q: How much is Typingjobs.org worth?
A: Typingjobs.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Typingjobs.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Typingjobs.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Typingjobs.org

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Who hosts Typingjobs.org?

Typingjobs.org Hosting Provider Information

Hosted IP Address:34.102.136.180
Hosted Hostname:180.136.102.34.bc.googleusercontent.com
Service Provider:DoD Network Information Center
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:openresty

Is "DoD Network Information Center" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Typingjobs.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Fri, 30 Oct 2020 01:50:45 GMT
Content-Type: text/html
Content-Length: 2522
Last-Modified: Thu, 29 Oct 2020 16:54:11 GMT
ETag: "5f9af3b3-9da"
X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAJRmzcpTevQqkWn6dJuX/N/Hxl7YxbOwy8 73ijqYSQEN WGxrruAKtZtliWC86 ewQ0msW1W8psOFL/b00zWqsCAwEAAQ_MY7b6I3iMlZkWIuR3ttuaSbf5GZPx6/iE6mZ5RcjWWAry8woJ4tZELXKNfnQ6r5hna9menOgAheTWtNqDcIi8A
Accept-Ranges: bytes
Via: 1.1 google

Typingjobs.org Domain Nameserver Information

HostIP AddressCountry
ns05.domaincontrol.com 97.74.102.3
ns06.domaincontrol.com 173.201.70.3


Need to find out who hosts Typingjobs.org?


Domain Registration (WhoIs) information for Typingjobs.org

Websites with Similar Names

Typin.xyz
typin.xyz - Registered at Namecheap.com
Typing-administration-accounting.com
Typing, Admin, Accounts | typingadminaccoun
Typing-and-duplication.panikad.com
آگهی رایگان :: تبلیغات رایگان :: نیازمندیها - تایپ و تکثیر
Typing-game.org
Typing Game
Typing-games-for-kids.com
Best Typing Games for Kids
Typing-games.org
Free Typing Games Online
Typing-lessons.org
Peter's Online Typing Course - Learn Keyboarding Online!
Typing-service.com
HugeDomains.com - Shop for over 300,000 Premium Domains

Recently Updated Websites

Ksrassia.com (4 seconds ago.)Ldapp626.com (6 seconds ago.)Lady-hamilton.com (9 seconds ago.)Jdehomesolutions.com (11 seconds ago.)Johnstoneproposeyd.com (16 seconds ago.)Ladangpkv.com (16 seconds ago.)Kenhdongy.com (19 seconds ago.)Konigsci.com (20 seconds ago.)Interstaltd.com (20 seconds ago.)Jeffmaihack.com (20 seconds ago.)Jamiyyahhadiyu.com (22 seconds ago.)Iesmaritim.com (22 seconds ago.)J-villeriders.com (25 seconds ago.)Jasonkakuyo.com (27 seconds ago.)Leopard-consulting.com (27 seconds ago.)Ldapp733.com (28 seconds ago.)Lawsworthlp.com (29 seconds ago.)Idrataria.com (30 seconds ago.)Insumosvite.com (30 seconds ago.)Lasorpresadeopalos.com (33 seconds ago.)Ldapp585.com (33 seconds ago.)Isdarrylhomeless.com (33 seconds ago.)Ldapp734.com (34 seconds ago.)Jovenesporelcambio.com (34 seconds ago.)Htxhungtien.com (38 seconds ago.)Jamiegibbonsstudio.com (38 seconds ago.)Ishikawas.com (38 seconds ago.)Ldapp770.com (38 seconds ago.)Iijertyu.com (40 seconds ago.)Kpppl.com (40 seconds ago.)

Recently Searched Keywords

itemstitlejuanitas tortilla chipslinktargetblanktypewixdatapageidchhjdtargetselftypepagelinkpagenamejuanitas (2 seconds ago.)drbnler (5 seconds ago.)yele (13 seconds ago.)live flight tracking (13 seconds ago.)between (13 seconds ago.)west (port-au-prince) (14 seconds ago.)harbor (16 seconds ago.)tx 78613 chinese pickup delivery order chinese food pickup delivery (20 seconds ago.)manhadunyulecheng558 (20 seconds ago.)incluido context httpschemaorg (21 seconds ago.)免費預約上門量尺寸 (22 seconds ago.)60 xsspacing (22 seconds ago.)design creating (23 seconds ago.)home staging madison wi (24 seconds ago.)array linktargetblanktypewixdatapageidldaidtargetselftypepagelinkpagenamethe (25 seconds ago.)importantcomp-jvvknknm (25 seconds ago.)development of cyber physical systems (25 seconds ago.)licenses (26 seconds ago.)height documentreadyfunction (26 seconds ago.)color3f3f3fimportant (27 seconds ago.)летающие мечи врат дракона (2011) (27 seconds ago.)decorstyle (28 seconds ago.)itemstitlejuanitas tortilla chipslinktargetblanktypewixdatapageidchhjdtargetselftypepagelinkpagenamejuanitas (28 seconds ago.)eine sprechstunde mit charles cecil himself (28 seconds ago.)e99d (29 seconds ago.)生产基地 (29 seconds ago.)radio agora (30 seconds ago.)pray divine mercy chaplet pdf (31 seconds ago.)go dogs go (33 seconds ago.)deadlines and policies (36 seconds ago.)