Forums - TyreSmoke

Safety: Low trust score
Year Founded: 2002
Global Traffic Rank: 900,836
Estimated Worth: $1,440



Domain summary

Last updated
2021-10-28
Domain label
tyresmoke
Domain extension
net
Domain registered:
2002-07-31
Domain updated:
2021-08-02
Global Traffic Rank
900,836
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,440
Estimated daily income
$6
Estimated monthly income
$183

Frequently Asked Questions (FAQ)

Q: When was Tyresmoke.net registered?
A: Tyresmoke.net was registered 19 years, 3 months, 4 weeks, 2 days, 21 hours, 46 minutes, 26 seconds ago on Wednesday, July 31, 2002.
Q: When was the WHOIS for Tyresmoke.net last updated?
A: The WHOIS entry was last updated 3 months, 4 weeks, 21 hours, 46 minutes, 26 seconds ago on Monday, August 2, 2021.
Q: What are Tyresmoke.net's nameservers?
A: DNS for Tyresmoke.net is provided by the following nameservers:
  • beth.ns.cloudflare.com
  • phil.ns.cloudflare.com
Q: Who is the registrar for the Tyresmoke.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Tyresmoke.net?
A: Tyresmoke.net ranks 900,836 globally on Alexa. Tyresmoke.net has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Tyresmoke.net each day?
A: Tyresmoke.net receives approximately 977 visitors and 1,954 page impressions per day.
Q: What IP address does Tyresmoke.net resolve to?
A: Tyresmoke.net resolves to the IPv4 address .
Q: In what country are Tyresmoke.net servers located in?
A: Tyresmoke.net has servers located in the .
Q: What webserver software does Tyresmoke.net use?
A: Tyresmoke.net is powered by CloudFlare webserver.
Q: Who hosts Tyresmoke.net?
A: Tyresmoke.net is hosted by Unknown in .
Q: How much is Tyresmoke.net worth?
A: Tyresmoke.net has an estimated worth of $1,440. An average daily income of approximately $6, which is roughly $183 per month.

Tyresmoke.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Tyresmoke.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Tyresmoke.net

H1 Headings

1 :
  1. Forums

H2 Headings

8 :
  1. General Stuff
  2. Audi Forums
  3. VW Forums
  4. BMW Forums
  5. Various Car Forums
  6. TSN Partner Forums
  7. Random Area
  8. Sign up

H3 Headings

2 :
  1. Member Statistics
  2. Recent Achievements

H4 Headings

65 :
  1. Sign In
  2. TSN Motor News
  3. Audi Forum
  4. Porsche Forum
  5. Welcome Forum
  6. General Cars
  7. Motor Sport
  8. Meets & Trackdays
  9. Tyresmoke Reviews
  10. Dealer/Supplier/Specialist
  11. Tuning/Tuners
  12. Cleaning
  13. Car Electronics, Satnav, I.C.E and multimedia
  14. Spotted
  15. Vag-Com
  16. General Marketplace
  17. KneeSliders
  18. TyreSmoke Issues
  19. Audi Technical
  20. Audi RS3 Forum
  21. Audi A4/S4/Cabrio
  22. Audi A5/S5/Cabrio
  23. Audi A6/S6/A7/S7
  24. Audi A8/S8
  25. Audi TT/TTR
  26. Audi Q3/Q5/Q7
  27. Audi RS
  28. Audi R8
  29. VW Chat
  30. VW Scirocco
  31. VW Technical
  32. VW Lupo/Polo
  33. VW Golf/Bora/New Beetle
  34. VW Passat
  35. VW Phaeton/Touareg/Tiguan
  36. VW Golf GTi Forum
  37. VW R Forum
  38. BMW Chat
  39. BMW Technical
  40. BMW 1/2 Series
  41. BMW 3/4 Series
  42. BMW 5/6/7/8 Series
  43. BMW X Series
  44. BMW Z3/Z4/Z8
  45. BMW 'M' Forums
  46. TVR
  47. Oil Burners
  48. Mercedes Benz Forum
  49. Aussie V8's
  50. Classics
  51. Mini Cooper / Cooper S
  52. Seat / Skoda
  53. French Forum
  54. Italian cars
  55. Japanese Performance Forums
  56. Sniff Petrol
  57. MotorPunk
  58. Agony Aunt
  59. Rubber Room
  60. Technology Corner
  61. Sports Forum
  62. HolidayPlace
  63. Health & Fitness
  64. Browse
  65. Activity

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

75 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-27216945-1

Links - Internal

319:

Keyword Cloud for Tyresmoke.net

2017 vw2019 auditrueseriesupfebruaryyoumotor1audiforum for generalfindnovemberpmscottycarvwsearchthoseurlampsign up8performance12kearned a badge12k postsherecontextyour0750pm morrisonbrink7earnedsocruiser647may10generalaprilipssetsettingbadge50750 pm3fewonehttpswwwtyresmokenetforumfitness14technicalforum forumpostforum for alltyreesesjulypostsporscheanynameonlinemarch11signpassatnewidspecificvartyresmoke016posts specificallaugustchatcarsr8series forum17decemberjanuary12contenttechnical forumpm morrisonbrink earnedmyforum for postsseptemberforumsnot15vagcom4morrisonbrinkoctoberbmwactivitymonday at 0750rs3forumall yourresultsjunesciroccoall you6ebmwposts audiall activitymonday13moreissuestypetalkposts bmwmorrisonbrink earned9218

Longtail Keyword Density for Tyresmoke.net

KeywordsOccurences
forum for posts21
forum for all7
earned a badge5
forum for general4
pm morrisonbrink earned3
monday at 07503
posts specific20
sign up5
forum forum5
all activity4
12k posts4
2017 vw4
series forum4
2019 audi3
posts audi3
all your3
technical forum3
posts bmw3
all you3
pm morrisonbrink3
morrisonbrink earned3
0750 pm3
posts90
forum56
audi25
bmw20
specific20
vw18
all17
014
series12
111
forums11
ipssetsetting11
october10
new10
general10
210
sign10
car9
activity8
type8
37
february7
you7
amp7
content7
46
my6
true6
technical6
one6
your6
more5
55
cruiser6475
65
january5
up5
july5
december5
september5
search5
november5
august5
may5
earned5
badge5
pm5
75
june5
84
talk4
march4
94
rs34
104
httpswwwtyresmokenetforum4
12k4
url4
motor4
114
chat4
so4
april4
here4
post4
124
134
cars4
tyresmoke4
144
153
morrisonbrink3
monday3
var3
07503
s3
not3
context3
id3
porsche3
name3
fitness3
e-bmw3
issues3
results3
those3
scotty3
performance3
find3
online3
few3
any3
passat3
163
173
183
r83
vag-com3
scirocco3
tyreese3

Who hosts Tyresmoke.net?

Tyresmoke.net Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:CloudFlare

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
15.7989%
GOOGLE
14.3607%
AS-26496-GO-DADDY-COM-LLC
3.8534%
NAMECHEAP-NET
3.1479%
AMAZON-AES
2.3132%
GoDaddy.com, LLC
2.0763%
UNIFIEDLAYER-AS-1
1.9874%
Fara Negar Pardaz Khuzestan
1.6407%
CONFLUENCE-NETWORK-INC
1.4732%
1&1 Internet AG
1.3797%

HTTP Header Analysis for Tyresmoke.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 28 Oct 2021 12:36:26 GMT
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
vary: Accept-Encoding
x-ips-loggedin: 0
x-xss-protection: 0
x-frame-options: sameorigin
referrer-policy: strict-origin-when-cross-origin
expires: Thu, 28 Oct 2021 12:46:26 GMT
cache-control: max-age=600, public, s-maxage=600, stale-while-revalidate, stale-if-error
last-modified: Thu, 28 Oct 2021 12:36:26 GMT
x-wdfy-cache-status: EXPIRED
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=cfZyiezJMI7BT5WGhre8pr4ScxmK6PmGX43jwH8RTt5GApDnDnbVyp23cjN4bLCiISoGBwRyU4mAst4+qFPGBOvu2ToOPjXVdVcnTt5t7+EcMNIDmU8TscmmuWuElAFFf0LOZw=="}],"group":"cf-nel","max_age":604800}
NEL: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 6a5435ae5df371fe-LHR
Content-Encoding: gzip
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400, h3-28=":443"; ma=86400, h3-27=":443"; ma=86400

Tyresmoke.net Domain Nameserver Information

HostIP AddressCountry
beth.ns.cloudflare.com 173.245.58.103
phil.ns.cloudflare.com 172.64.33.137


Need to find out who hosts Tyresmoke.net?


Domain Registration (WhoIs) information for Tyresmoke.net

 Domain Name: TYRESMOKE.NET
Registry Domain ID: 88897202_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-05-15T18:01:57Z
Creation Date: 2002-07-31T05:07:17Z
Registrar Registration Expiration Date: 2022-07-31T05:07:17Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 2155 E Warner Rd
Registrant City: Tempe
Registrant State/Province: Arizona
Registrant Postal Code: 85284
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: +1.4806242598
Registrant Fax Ext:
Registrant Email: Login to show email
Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 2155 E Warner Rd
Tech City: Tempe
Tech State/Province: Arizona
Tech Postal Code: 85284
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: +1.4806242598
Tech Fax Ext:
Tech Email: Login to show email
Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 2155 E Warner Rd
Admin City: Tempe
Admin State/Province: Arizona
Admin Postal Code: 85284
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: +1.4806242598
Admin Fax Ext:
Admin Email: Login to show email
Server: BETH.NS.CLOUDFLARE.COM
Name Server: PHIL.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-10-28T12:36:26Z

Websites with Similar Names

Tyres-2-u-norwich.co.uk
Tyres 2 U | Tyre Fitting and Repair Service Norwich
Tyres-and-co.us
tiresandco.com
Tyres-b2b.net
Tyreman - Tyre Trade Computer Software, Services and Systems specialists
Tyres-bh.com
Tyres online - Price comparison - Tyres.net
Tyres-burnley.co.uk
SITE NOT FOUND
Tyres-cyprus.com
Tyres online - Price comparison - Tyres.net
Tyres-direct.com
HugeDomains.com
Tyres-easy.com
Buy cheap tyres online @ mytyres.co.uk - tyre dealer for affordable car tyres
Tyres-exhausts-brakes-orpington.com
Tyres Exhausts Brakes Orpington | PTA Garages

Recently Updated Websites

Firespiceandseasoningcompanyllc.company (8 seconds ago.)Cpbet777.app (8 seconds ago.)Glenmore-community.org (9 seconds ago.)Cr1998.com (9 seconds ago.)Toddpurcellmortgages.com (12 seconds ago.)Opensax.org (16 seconds ago.)Ananyadancetheatre.org (18 seconds ago.)Hotel-cohyli.com (21 seconds ago.)Alanirvincpa.com (28 seconds ago.)Servicegitar.com (29 seconds ago.)Recuvaformac.com (36 seconds ago.)Oneplace.net (36 seconds ago.)Yibobet6695.com (37 seconds ago.)Hcscrosscountry.com (37 seconds ago.)Sinsae.net (45 seconds ago.)Godfjord.no (46 seconds ago.)Atv-berlin.de (47 seconds ago.)Dreamportoutfitters.store (47 seconds ago.)Hopeforhh.org (49 seconds ago.)Vqb.org (51 seconds ago.)Fosforus.com (57 seconds ago.)Devobros.guru (58 seconds ago.)Universalshades.com (1 minute ago.)Ncaasafety.com (1 minute 1 second ago.)Satun-fisheries.com (1 minute 1 second ago.)Blogplusdollars.com (1 minute 3 seconds ago.)Pcmsys.com (1 minute 4 seconds ago.)Cannabistraws.com (1 minute 5 seconds ago.)Galeri21otomotiv.org (1 minute 6 seconds ago.)Zengardenbook.com (1 minute 10 seconds ago.)

Recently Searched Keywords

fairanchorage (1 second ago.)ajman free zone company (1 second ago.)가포 온열 찜질기 hp039 (1 second ago.)recruiting class rankings basketball (2 seconds ago.)astm f1862 iso22609 (2 seconds ago.)perfect health fit (2 seconds ago.)سپتیک تانک (3 seconds ago.)06430 (3 seconds ago.)ovashape (4 seconds ago.)038 happeningsmedianews 038 (4 seconds ago.)فرش ماشینی 700 شانه 8 رنگ (5 seconds ago.)外语教学与研究出版社+翻译 (5 seconds ago.)dallas oregon weather (5 seconds ago.)must thank (6 seconds ago.)do everything (6 seconds ago.)malaysiainvolvement of small (7 seconds ago.)data-product-id4877633585232quickbuy-form quickbuyproduct-media-2 (7 seconds ago.)attr class (7 seconds ago.)caiwoe.com (8 seconds ago.)2019试试这款浏览器扩展 (8 seconds ago.)интересные идеи для вдохновения (8 seconds ago.)media alliance of zimbabwe (9 seconds ago.)inclusive and responsible (9 seconds ago.)nhân sâm (10 seconds ago.)recetas de botanas fáciles (10 seconds ago.)cameretta (11 seconds ago.)pain read (11 seconds ago.)homogeneous and heterogeneous multi-core architectures (11 seconds ago.)25 september 2020 (12 seconds ago.)convertidor utm a clp (12 seconds ago.)