High trust score |
Система для создания сайтов, конструктор сайтов нового поколения, бесплатный хостинг.
Ucoz.ru Website Information
Website Ranks & Scores for Ucoz.ru
 Statvoo Rank: | B |
 Alexa Rank: | 1,210 |
 Majestic Rank: | 855 |
 Domain Authority: | 93% |
 DMOZ Listing: | Yes |
Whois information for ucoz.ru
Full Whois Lookup for Ucoz.ru Whois Lookup
WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Ucoz.ru. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.
% By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).
domain: UCOZ.RU
nserver: ns1.ucoz.ru. 195.216.243.104
nserver: ns2.ucoz.ru. 213.174.157.200
nserver: ns3.ucoz.ru. 190.115.19.142
state: REGISTERED, DELEGATED, VERIFIED
org: Compubyte Limited
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2005-08-20T20:00:00Z
paid-till: 2018-08-20T21:00:00Z
free-date: 2018-09-21
source: TCI
Last updated on 2017-08-16T05:06:33Z
Who hosts Ucoz.ru?
Ucoz.ru is hosted by JSC QUICKLINE in Moscow City, Moscow, Russian Federation, 115088.
Ucoz.ru has an IP Address of 217.199.217.120 and a hostname of dev120.ucoz.net.
Ucoz.ru Web Server Information
| Hosted IP Address: | 217.199.217.120 |
| Hosted Hostname: | dev120.ucoz.net |
| Service Provider: | JSC QUICKLINE |
| Hosted Country: |  RU |
| Location Latitude: | 55.7522 |
| Location Longitude: | 37.6156 |
| Webserver Software: | Not Applicable |
HTTP Header Analysis for Ucoz.ru
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Server: | uServ/3.2.2 |
| Date: | Fri, 22 May 2015 12:03:33 GMT |
| Content-Type: | text/html; charset=UTF-8 |
| Transfer-Encoding: | chunked |
| Connection: | keep-alive |
| Keep-Alive: | timeout=15 |
| Content-Encoding: | gzip |
Need to find out who hosts Ucoz.ru?
Ucoz.ru Free SEO Report
Website Inpage Analysis for Ucoz.ru
| H1 Headings: | 0 | ||
| H2 Headings: | 0 | ||
| H3 Headings: | 0 | ||
| H4 Headings: | 0 | ||
| H5 Headings: | 0 | ||
| H6 Headings: | 0 | ||
| Total IFRAMEs: | 0 | ||
| Total Images: | 0 | ||
| Google Adsense: | Not Applicable | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Ucoz.ru
else ifupartnerimaccssaddclassfadeinleft5navbutton aaddclassdark fpnavfpnav uladdclassblack ifindexusocialaaddclassdark fpnav uladdclassblack4addclassfadeinright navbuttonwindowheightuladdclassblack ifindexsliderformeuranleadfittextvw5uladdclasswhitevarfpnav uladdclasswhitebackgroundimageupartnerimaccss backgroundimagenavbutton aaddclasslight fpnavelsexscrollfunction0ukit ushopaddclassfadeoutleft6ucoz7ushopremoveclassfadeoutrightaaddclasslight fpnavaddclassfadeoutright ifindexuidaaddclasslightsectionreturnaaddclassdarkpagewidthtogglesliderifyscrollfpnav uladdclassblackaaddclassdark fpnavucoz ukitsliderwebshops3uladdclassblacktruenavbuttonifindexgetpagesize3navbutton aaddclassdarkaddclassfadeoutrightaaddclasslight fpnav uladdclasswhite1ukith2addclasszoominaddclassfadeinrightpageheightfalsefpnavwindowwidthexplorer2lazyloadedbackgroundimageuid uidnavbutton aaddclasslight
Longtail Keyword Density for Ucoz.ru
| Keywords | Occurences |
|---|---|
| nav-button aaddclassdark fp-nav | 5 |
| aaddclasslight fp-nav uladdclasswhite | 4 |
| nav-button aaddclasslight fp-nav | 4 |
| fp-nav uladdclassblack ifindex | 4 |
| aaddclassdark fp-nav uladdclassblack | 4 |
| nav-button aaddclassdark | 6 |
| aaddclassdark fp-nav | 5 |
| aaddclasslight fp-nav | 4 |
| fp-nav uladdclasswhite | 4 |
| else if | 4 |
| nav-button aaddclasslight | 4 |
| uladdclassblack ifindex | 4 |
| fp-nav uladdclassblack | 4 |
| ucoz ukit | 3 |
| upartner-imaccss backgroundimage | 3 |
| addclassfadeoutright ifindex | 3 |
| addclassfadeinright nav-button | 3 |
| ukit ushop | 3 |
| uid uid | 3 |
| ifindex | 19 |
| lazyloadedbackground-image | 13 |
| nav-button | 12 |
| if | 10 |
| fp-nav | 10 |
| windowwidth | 8 |
| else | 8 |
| yscroll | 7 |
| var | 7 |
| addclassfadeoutright | 7 |
| xscroll | 7 |
| slider-web-shops | 7 |
| windowheight | 7 |
| usocial | 6 |
| ucoz | 6 |
| addclassfadeoutleft | 6 |
| slider-for-me | 6 |
| true | 6 |
| aaddclassdark | 6 |
| section | 5 |
| explorer | 5 |
| 0 | 5 |
| uid | 5 |
| 1 | 5 |
| function | 5 |
| getpagesize3 | 4 |
| leadfittextvw5 | 4 |
| 2 | 4 |
| aaddclasslight | 4 |
| uladdclassblack | 4 |
| 3 | 4 |
| false | 4 |
| uladdclasswhite | 4 |
| ukit | 4 |
| addclassfadeinright | 4 |
| addclassfadeinleft | 4 |
| ushop | 3 |
| pageheight | 3 |
| pagewidth | 3 |
| uran | 3 |
| backgroundimage | 3 |
| upartner-imaccss | 3 |
| h2addclasszoomin | 3 |
| 4 | 3 |
| 5 | 3 |
| removeclassfadeoutright | 3 |
| 6 | 3 |
| return | 3 |
| 7 | 3 |
| toggleslider | 3 |
What are the nameservers for ucoz.ru?
Ucoz.ru Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.ucoz.ru |  | 195.216.243.104 |  United Kingdom |
| ns2.ucoz.ru | | 213.174.157.200 |  United States |