Ucoz.ru  |  Бесплатный конструктор сайтов - система для создания сайтов - uCoz
High trust score  | 
Система для создания сайтов, конструктор сайтов нового поколения, бесплатный хостинг.




Ucoz.ru Website Information

Website Ranks & Scores for Ucoz.ru

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:1,210
Majestic Rank Majestic Rank:855
Domain Authority Domain Authority:93%
DMOZ DMOZ Listing:Yes

Whois information for ucoz.ru

Full Whois Lookup for Ucoz.ru Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Ucoz.ru. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: UCOZ.RU
nserver: ns1.ucoz.ru. 195.216.243.104
nserver: ns2.ucoz.ru. 213.174.157.200
nserver: ns3.ucoz.ru. 190.115.19.142
state: REGISTERED, DELEGATED, VERIFIED
org: Compubyte Limited
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2005-08-20T20:00:00Z
paid-till: 2018-08-20T21:00:00Z
free-date: 2018-09-21
source: TCI

Last updated on 2017-08-16T05:06:33Z

Who hosts Ucoz.ru?

Ucoz.ru is hosted by JSC QUICKLINE in Moscow City, Moscow, Russian Federation, 115088.
Ucoz.ru has an IP Address of 217.199.217.120 and a hostname of dev120.ucoz.net.



Ucoz.ru Web Server Information

Hosted IP Address:217.199.217.120
Hosted Hostname:dev120.ucoz.net
Service Provider:JSC QUICKLINE
Hosted Country:RussiaRU
Location Latitude:55.7522
Location Longitude:37.6156
Webserver Software:Not Applicable

HTTP Header Analysis for Ucoz.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: uServ/3.2.2
Date: Fri, 22 May 2015 12:03:33 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=15
Content-Encoding: gzip


Need to find out who hosts Ucoz.ru?

Ucoz.ru Free SEO Report

Website Inpage Analysis for Ucoz.ru

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Ucoz.ru

else ifupartnerimaccssaddclassfadeinleft5navbutton aaddclassdark fpnavfpnav uladdclassblack ifindexusocialaaddclassdark fpnav uladdclassblack4addclassfadeinright navbuttonwindowheightuladdclassblack ifindexsliderformeuranleadfittextvw5uladdclasswhitevarfpnav uladdclasswhitebackgroundimageupartnerimaccss backgroundimagenavbutton aaddclasslight fpnavelsexscrollfunction0ukit ushopaddclassfadeoutleft6ucoz7ushopremoveclassfadeoutrightaaddclasslight fpnavaddclassfadeoutright ifindexuidaaddclasslightsectionreturnaaddclassdarkpagewidthtogglesliderifyscrollfpnav uladdclassblackaaddclassdark fpnavucoz ukitsliderwebshops3uladdclassblacktruenavbuttonifindexgetpagesize3navbutton aaddclassdarkaddclassfadeoutrightaaddclasslight fpnav uladdclasswhite1ukith2addclasszoominaddclassfadeinrightpageheightfalsefpnavwindowwidthexplorer2lazyloadedbackgroundimageuid uidnavbutton aaddclasslight

Longtail Keyword Density for Ucoz.ru

KeywordsOccurences
nav-button aaddclassdark fp-nav5
aaddclasslight fp-nav uladdclasswhite4
nav-button aaddclasslight fp-nav4
fp-nav uladdclassblack ifindex4
aaddclassdark fp-nav uladdclassblack4
nav-button aaddclassdark6
aaddclassdark fp-nav5
aaddclasslight fp-nav4
fp-nav uladdclasswhite4
else if4
nav-button aaddclasslight4
uladdclassblack ifindex4
fp-nav uladdclassblack4
ucoz ukit3
upartner-imaccss backgroundimage3
addclassfadeoutright ifindex3
addclassfadeinright nav-button3
ukit ushop3
uid uid3
ifindex19
lazyloadedbackground-image13
nav-button12
if10
fp-nav10
windowwidth8
else8
yscroll7
var7
addclassfadeoutright7
xscroll7
slider-web-shops7
windowheight7
usocial6
ucoz6
addclassfadeoutleft6
slider-for-me6
true6
aaddclassdark6
section5
explorer5
05
uid5
15
function5
getpagesize34
leadfittextvw54
24
aaddclasslight4
uladdclassblack4
34
false4
uladdclasswhite4
ukit4
addclassfadeinright4
addclassfadeinleft4
ushop3
pageheight3
pagewidth3
uran3
backgroundimage3
upartner-imaccss3
h2addclasszoomin3
43
53
removeclassfadeoutright3
63
return3
73
toggleslider3

What are the nameservers for ucoz.ru?

Ucoz.ru Domain Nameserver Information

HostIP AddressCountry
ns1.ucoz.ru 195.216.243.104United Kingdom United Kingdom
ns2.ucoz.ru 213.174.157.200United States United States

Ucoz.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Ucoz.ru is a scam?