UFACTORY Official Website – store.ufactory.cc

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9

Open Source, Robotic Arm, Automation, Blockly, Python, ROS, Arduino



Domain summary

Last updated
2021-04-22
Domain label
ufactory
Domain extension
cc
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Ufactory.cc registered?
A: Ufactory.cc was registered 4 months, 4 weeks, 2 hours, 1 minute, 8 seconds ago on Thursday, April 22, 2021.
Q: When was the WHOIS for Ufactory.cc last updated?
A: The WHOIS entry was last updated 4 months, 4 weeks, 2 hours, 1 minute, 8 seconds ago on Thursday, April 22, 2021.
Q: What are Ufactory.cc's nameservers?
A: DNS for Ufactory.cc is provided by the following nameservers:
  • dns9.hichina.com
  • dns10.hichina.com
Q: Who is the registrar for the Ufactory.cc domain?
A: The domain has been registered at .
Q: What is the traffic rank for Ufactory.cc?
A: Ufactory.cc has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Ufactory.cc each day?
A: Ufactory.cc receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Ufactory.cc resolve to?
A: Ufactory.cc resolves to the IPv4 address 23.227.38.65.
Q: In what country are Ufactory.cc servers located in?
A: Ufactory.cc has servers located in the Canada.
Q: What webserver software does Ufactory.cc use?
A: Ufactory.cc is powered by CloudFlare webserver.
Q: Who hosts Ufactory.cc?
A: Ufactory.cc is hosted by Shopify, Inc. in Canada.
Q: How much is Ufactory.cc worth?
A: Ufactory.cc has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Ufactory.cc Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Ufactory.cc Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Ufactory.cc

H1 Headings

0 :

H2 Headings

2 :
  1. Just added to your cart
  2. AUTOMATE YOUR DEVIVE TESTSTARTING AT

H3 Headings

27 :
  1. ONE-STOP ROBOT ARM SOLUTIONS STARTING AT
  2. Automate Your Device TestStarting At
  3. Cost-effective Service Robot
  4. 5kg
  5. Payload
  6. 700mm
  7. Reach
  8. The Most Durable Desktop Robotic Arm
  9. 500g
  10. Payload
  11. 320mm
  12. Reach
  13. Coffee Machine
  14. Pick and Place
  15. Education
  16. Keyboard Testing
  17. Downloads & Support
  18. Stay Up To Date
  19. Shop
  20. BUSINESS PARTNERS
  21. ONE-STOP ROBOT ARM SOLUTIONSSTARTING AT
  22. $ 749
  23. 5kg
  24. 700mm
  25. 500g
  26. 320mm
  27. BUSINESS PARTNERS

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

28 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-46313706-9

Links - Internal

30:

Links - Internal (nofollow)

0:

Keyword Cloud for Ufactory.cc

borderbottomborderbottom 1px solidwinboomrlsolidservice ampuarmsearchamp resourcestypeusscriptresourcesxarmfunctionvarstoreufactorycctrueservice amp resourcescontact ussitefooterrtecontactyourahover0elseampif1px soliddategettimeservice1pxnew dategettimeelse ifcolorborderbottom 1pxsitefooternewshop5a5858cartsdk

Who hosts Ufactory.cc?

Ufactory.cc Hosting Provider Information

Hosted IP Address:23.227.38.65
Hosted Hostname:zagat.ssl.shopify.com
Service Provider:Shopify, Inc.
Hosted Country:CanadaCA
Location Latitude:43.6319
Location Longitude:-79.3716
Webserver Software:CloudFlare

Is "Shopify, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Shopify, Inc.
0.9667%

HTTP Header Analysis for Ufactory.cc

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 22 Apr 2021 19:38:35 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Sorting-Hat-PodId: 117
X-Sorting-Hat-ShopId: 1269792886
X-Storefront-Renderer-Rendered: 1
ETag: cacheable:2ca16dd05c4342dfd30ab055c3614721
X-Alternate-Cache-Key: cacheable:7f30f1b12a4a10296f9a94a437963966
Content-Encoding: gzip
X-Cache: miss
X-Frame-Options: DENY
Content-Security-Policy: block-all-mixed-content; frame-ancestors 'none'; upgrade-insecure-requests;
Strict-Transport-Security: max-age=7889238
X-ShopId: 1269792886
X-ShardId: 117
Vary: Accept
Content-Language: en
X-Shopify-Stage: production
X-Dc: gcp-us-central1,gcp-us-central1,gcp-us-central1
X-Request-ID: 3d4a6c67-15e9-4ad9-bede-74c88172400d
X-Content-Type-Options: nosniff
X-Permitted-Cross-Domain-Policies: none
X-XSS-Protection: 1; mode=block
X-Download-Options: noopen
NEL: {"report_to":"network-errors","max_age":2592000,"success_fraction":0.0001}
Report-To: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifysvc.com/v1/reports/nel/20190325/shopify"}]}
CF-Cache-Status: DYNAMIC
cf-request-id: 099cb0744700005415612f7000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 64415033a9355415-LHR
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Ufactory.cc Domain Nameserver Information

HostIP AddressCountry
dns9.hichina.com 106.11.141.125
dns10.hichina.com 106.11.211.56


Need to find out who hosts Ufactory.cc?


Domain Registration (WhoIs) information for Ufactory.cc

 Domain Name: UFACTORY.CC
Registry Domain ID: 107858274_DOMAIN_CC-VRSN
Registrar WHOIS Server: grs-whois.hichina.com
Registrar URL: http://www.net.cn
Updated Date: 2017-08-18T09:50:20Z
Creation Date: 2013-09-05T15:05:53Z
Registry Expiry Date: 2026-09-05T15:05:53Z
Registrar: Alibaba Cloud Computing (Beijing) Co., Ltd.
Registrar IANA ID: 420
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +86.95187
Domain Status: ok https://icann.org/epp#ok
Name Server: DNS10.HICHINA.COM
Name Server: DNS9.HICHINA.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-11-10T22:52:52Z

Websites with Similar Names

Ufact.net
uFact - ??????? ????????
Ufactionmusic.com
Welcome ufactionmusic.com - BlueHost.com
Ufactions.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Ufactoring.com
ФАКТОРИНГ ХАБ Ufactoring.com
Ufactory.cc
UFACTORY Official Website – store.ufactory.cc
Ufactualize.com
UF Actualize | EQ | Student-Run Organization | Florida
Ufacturae.com
Domain Default page

Recently Updated Websites

Ptc.click (2 seconds ago.)Vendremapropriete.info (4 seconds ago.)Saporiditaliatogo.com (5 seconds ago.)Konsor-logistik.de (6 seconds ago.)Kuz.xyz (6 seconds ago.)Itsmae.com (7 seconds ago.)Gaypublicfun.com (8 seconds ago.)Changingthefacesummit.com (9 seconds ago.)Passionprojectpublishing.com (10 seconds ago.)Therself.com (11 seconds ago.)Freerobu.com (12 seconds ago.)Dealsshopify.com (12 seconds ago.)Transbustamante.com (12 seconds ago.)Thevoiceofitaly.com (12 seconds ago.)Gdylbxgjs.com (12 seconds ago.)Appnorthwest.com (13 seconds ago.)Hopkintonsdb.com (14 seconds ago.)Vamosshop.app (16 seconds ago.)Hongyelawyer.com (16 seconds ago.)Banglamovie.in (16 seconds ago.)Dvcclga.com (18 seconds ago.)Highspeedsoldier.com (18 seconds ago.)Shadygrovebullmastiffs.com (19 seconds ago.)Fisssh.com (20 seconds ago.)Thetopfloormelbourne.com (21 seconds ago.)Registered-talaaq.com (21 seconds ago.)Russia-ukraine-byelorussia.com (21 seconds ago.)Rethinkvenezuela.com (21 seconds ago.)Deltsdentalnj.com (22 seconds ago.)Fuckoff.co (22 seconds ago.)

Recently Searched Keywords

whio radar (1 second ago.)rocky-52 (2 seconds ago.)denzel washington (3 seconds ago.)dtsk (3 seconds ago.)cometakeywordsseodesign design studio (4 seconds ago.)lego® dots (5 seconds ago.)сериал 1 сезон, 8 серия (5 seconds ago.)mvil dual (6 seconds ago.)comentarios fotos instagram (7 seconds ago.)8+px (9 seconds ago.)folder: projects (9 seconds ago.)plus oppo (10 seconds ago.)cathes (11 seconds ago.)343434 langtranslator dropdown (12 seconds ago.)cá kho làng vũ đại thương hiệu dasavina đạt danh hiệu vàng – món ngon tinh hoa ẩm thực việt 2014 (12 seconds ago.)2020 1 minute (13 seconds ago.)rubyhott69 (13 seconds ago.)085bordersolid (14 seconds ago.)сетевое издание 46тв (14 seconds ago.)s-font-bodylangsxl nav-dropdown-panels-font-body-raleway s-font-bodylangzh (16 seconds ago.)fulton (16 seconds ago.)jamii bora (17 seconds ago.)heatheredwardsband (19 seconds ago.)our ten programs (19 seconds ago.)wordpress jquery (20 seconds ago.)settimeoutshowtime10000 timerrunning true (21 seconds ago.)excerptstitlelinktargetblanktypewixdatapageidskrtwtypepagelinkpagenameoneill catalog (22 seconds ago.)最新章节 (23 seconds ago.)kunt bij ons (23 seconds ago.)счетчики газа (24 seconds ago.)