Ufcu.org  |  University Federal Credit Union | Austin, TX
Low trust score  | 
Austin's largest locally-owned financial institution, University Federal Credit Union provides a broad range of financial services to our Texas communities including a full-service branch in Galveston.

Ufcu.org Website Information

Website Ranks & Scores for Ufcu.org

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:40,044
Majestic Rank Majestic Rank:624,017
Domain Authority Domain Authority:34%
DMOZ DMOZ Listing:No

Whois information for ufcu.org

Full Whois Lookup for Ufcu.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Ufcu.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: UFCU.ORG
Registry Domain ID: D1407250-LROR
Registrar WHOIS Server:
Registrar URL: http://www.domaindiscover.com
Updated Date: 2017-08-12T05:01:51Z
Creation Date: 1994-09-20T04:00:00Z
Registry Expiry Date: 2018-09-19T04:00:00Z
Registrar Registration Expiration Date:
Registrar: TierraNet Inc. dba DomainDiscover
Registrar IANA ID: 86
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C14582453-LROR
Registrant Name: E-Commerce Administrator
Registrant Organization: University Federal Credit Union
Registrant Street: PO BOX 9350
Registrant City: Austin
Registrant State/Province: TX
Registrant Postal Code: 78766-9350
Registrant Country: US
Registrant Phone: +1.5124678080
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C161519868-LROR
Admin Name: E-Commerce Administrator
Admin Organization: University Federal Credit Union
Admin Street: PO BOX 9350
Admin City: Austin
Admin State/Province: TX
Admin Postal Code: 78766-9350
Admin Country: US
Admin Phone: +1.5124678080
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C14582453-LROR
Tech Name: E-Commerce Administrator
Tech Organization: University Federal Credit Union
Tech Street: PO BOX 9350
Tech City: Austin
Tech State/Province: TX
Tech Postal Code: 78766-9350
Tech Country: US
Tech Phone: +1.5124678080
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS3.P05.DYNECT.NET
Name Server: NS1.P05.DYNECT.NET
Name Server: NS2.P05.DYNECT.NET
Name Server: NS4.P05.DYNECT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-18T14:00:58Z

Who hosts Ufcu.org?

Ufcu.org is hosted by Armor Defense Inc in Texas, Richardson, United States, 75082.
Ufcu.org has an IP Address of and a hostname of and runs Microsoft-IIS/8.0 web server.

Ufcu.org Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Armor Defense Inc
Hosted Country:United StatesUS
Location Latitude:32.9924
Location Longitude:-96.6821
Webserver Software:Microsoft-IIS/8.0
Google Map of 50,12

HTTP Header Analysis for Ufcu.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/8.0
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Tue, 16 Jun 2015 22:45:50 GMT
Content-Length: 31293

Need to find out who hosts Ufcu.org?

Ufcu.org Free SEO Report

Website Inpage Analysis for Ufcu.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Ufcu.org

calltrueright 0financingdocumentcreateelementinputif windowwidthdesktoptabsheaderanimate rightcuso financialidweresultstrabsolutemovedcansameyournavigationyour retirementpersonaltogglesecuritycommerciallearn moremaincontaineranimate rightfreeonlineduration animationdurationaccount or applyfinancial services lpreturn falsehometabs2 liactivehometabs2federal credit uniondocumentaccount learnopenopen an accountfeesopen 0 monthlyoffered throughbuyersfinancialtabmenu tabcontentinvestmentfeejavascriptoptionsdocumentreadyfunctioninvestpropertyelse ifoutcontentstageiftoggle navigationliremoveclassactivenondeposit investment productsthrough cfsoffers the sameinsurepolicyaccount applysearchfalsenondeposit investmentufcu offersnewnbspcenterpromotionsroutingservicesspecialphotoincludingmembercompleteheaderanimatefederalmakelargerway310px important contentstageemployerreal0 durationratesjavascript documentclosesame low ratesyoureturntextcredit unionapplogoprivacyrewardsloansame lowbuy ownfinanceslookingmonthlyaug5haveuniversity federal creditduration animationduration completeofferedrateonline bankingpossiblerelative right autocommonheightanimationduration completeanimationdurationdo youloan applyufculocation2cardmonthly feeadvicebuyheightmaincontainercssdocumentgetelementbyid ctlusernamenotvehiclenumberupdate your contactprotect yourownflexible termsproductsmoney0 duration animationdurationopen account learnnondepositinvestment productscontactvehicle loan applyrelativen310pxfalse else returnsave moneynowlpposition absolutehaserrorsdocumentqueryselectordo1wheels 101informationaccountsposition relative4locationsfirstimportant contentstagethroughwe havelifelow ratesutservice0contact informationmostchecking savingsunionwindowwidthappyour mortgage0 monthlyvartxmortgagerelative rightplaninsurancedocumentgetelementbyidapplyelsememberscard applytravelehome loanestatetoolsusuniversity federalimportantheadercss positionhelp youdurationmobilecarheadercssmore most popularufcu mortgagetermbalancesbankingmobilesearchanimateaustin txfinancial servicesfalse elseupdatefee opentabmenu ultabstabmenudesktoprvaccount learn moreupdate yourcreditgetlearnhomecuso financial servicesliactivecredit card applyproducts and servicesrelative right 0emailopen 0nbsp learn moreregisteredcusoright autoreal estateembedcontainer310px importantampmore mosteventssavingspopularcloseallright searchpanelwidthcan wetabcontentsaveapply openrightfee open accountmaincontainercss position relativemortgage loanmarginvaluepersonal loanautorothwhetherfaqscardsanimationduration complete function0 monthly feeboatctlusernamelearn more mostright 0 durationreturn false elseaccountyour contact informationretirementmaincontaineranimatetxtpasswordyour contactmobilesearchanimate rightmoreultabsyour financeselse returncomplete functionuniversitymost popularwinwidthprocesshasoffersfunctioncfsmaincontainercss positionvehicle loanmyloans insurancemonthly fee openrates feesopen accountknowreturn trueprotectcheckingourpremiumfindhome loan applywheelswe helpbestheadercss position relativetodaynbsp learnsearchpanelwidthaustintopfederal creditcredit cardyour vehicletermspositioninputtypetextvalposition relative rightflexiblecan we helpneedlow3loansavailablehelpcurrentlyservices lp

Longtail Keyword Density for Ufcu.org

open an account8
position relative right7
account learn more6
open account learn6
animationduration complete function6
duration animationduration complete6
return false else5
open 0 monthly4
nbsp learn more4
monthly fee open4
fee open account4
learn more most4
0 monthly fee4
cuso financial services4
products and services4
0 duration animationduration4
right 0 duration4
relative right auto4
non-deposit investment products4
financial services lp4
more most popular4
university federal credit3
310px important content-stage3
same low rates3
offers the same3
federal credit union3
credit card apply3
false else return3
relative right 03
headercss position relative3
maincontainercss position relative3
update your contact3
your contact information3
home loan apply3
vehicle loan apply3
account or apply3
can we help3
learn more19
duration animationduration9
credit union9
right 09
position relative9
return false8
relative right7
online banking6
open account6
help you6
account learn6
most popular6
loan apply6
animationduration complete6
complete function6
false else5
protect your5
contact information5
if windowwidth5
flexible terms5
tabmenu ultabs4
offered through4
your finances4
buy own4
0 monthly4
more most4
wheels 1014
save money4
fee open4
monthly fee4
open 04
your mortgage4
tabmenu tab-content4
checking savings4
through cfs4
do you4
else if4
cuso financial4
financial services4
services lp4
non-deposit investment4
right auto4
nbsp learn4
austin tx4
investment products4
0 duration4
310px important3
important content-stage3
javascript document3
hometabs2 liactive3
federal credit3
university federal3
mortgage loan3
same low3
ufcu mortgage3
low rates3
your retirement3
your vehicle3
we have3
loans insurance3
headercss position3
headeranimate right3
else return3
return true3
update your3
maincontainercss position3
maincontaineranimate right3
we help3
position absolute3
mobilesearchanimate right3
right -searchpanelwidth3
your contact3
apply open3
rates fees3
toggle navigation3
real estate3
can we3
documentgetelementbyid ctlusername3
personal loan3
card apply3
account apply3
vehicle loan3
home loan3
credit card3
ufcu offers3

What are the nameservers for ufcu.org?

Ufcu.org Domain Nameserver Information

HostIP AddressCountry
ns3.p05.dynect.net States United States
ns1.p05.dynect.net States United States
ns2.p05.dynect.net States United States
ns4.p05.dynect.net States United States

Ufcu.org DNS Record Analysis DNS Lookup

ufcu.orgNS86400Target: ns2.p05.dynect.net
ufcu.orgNS86400Target: ns1.p05.dynect.net
ufcu.orgNS86400Target: ns4.p05.dynect.net
ufcu.orgNS86400Target: ns3.p05.dynect.net
ufcu.orgSOA3600MNAME: ns1.p05.dynect.net
RNAME: gpantzer.ufcu.org
Serial: 168
Refresh: 3600
Retry: 600
Expire: 604800
ufcu.orgMX60Priority: 20
Target: mailrelay1.ufcu.org
ufcu.orgMX60Priority: 20
Target: mailrelay2.ufcu.org

Alexa Traffic Rank for Ufcu.org

Alexa Search Engine Traffic for Ufcu.org