Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-05-09
Domain label
ug396bet
Domain extension
org
Domain registered:
2019-12-14
Domain updated:
2021-05-09
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Ug396bet.org registered?
A: Ug396bet.org was registered 1 year, 6 months, 1 week, 23 hours, 14 minutes, 54 seconds ago on Saturday, December 14, 2019.
Q: When was the WHOIS for Ug396bet.org last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 5 days, 23 hours, 14 minutes, 54 seconds ago on Sunday, May 9, 2021.
Q: What are Ug396bet.org's nameservers?
A: DNS for Ug396bet.org is provided by the following nameservers:
  • ns33.domaincontrol.com
  • ns34.domaincontrol.com
Q: Who is the registrar for the Ug396bet.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Ug396bet.org?
A: Ug396bet.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Ug396bet.org each day?
A: Ug396bet.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Ug396bet.org resolve to?
A: Ug396bet.org resolves to the IPv4 address 34.102.136.180.
Q: In what country are Ug396bet.org servers located in?
A: Ug396bet.org has servers located in the United States.
Q: What webserver software does Ug396bet.org use?
A: Ug396bet.org is powered by Openresty webserver.
Q: Who hosts Ug396bet.org?
A: Ug396bet.org is hosted by GOOGLE in Missouri, Kansas City, United States, 64121.
Q: How much is Ug396bet.org worth?
A: Ug396bet.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Ug396bet.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Ug396bet.org Free SEO Report

Website Inpage Analysis for Ug396bet.org

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Who hosts Ug396bet.org?

Ug396bet.org Hosting Provider Information

Hosted IP Address:34.102.136.180
Hosted Hostname:180.136.102.34.bc.googleusercontent.com
Service Provider:GOOGLE
Hosted Country:United StatesUS
Location Latitude:39.1027
Location Longitude:-94.5778
Webserver Software:openresty

Is "GOOGLE" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%

HTTP Header Analysis for Ug396bet.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Sun, 09 May 2021 06:25:24 GMT
Content-Type: text/html
Content-Length: 2522
Last-Modified: Sat, 08 May 2021 09:28:20 GMT
ETag: "609659b4-9da"
X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAJRmzcpTevQqkWn6dJuX/N/Hxl7YxbOwy8 73ijqYSQEN WGxrruAKtZtliWC86 ewQ0msW1W8psOFL/b00zWqsCAwEAAQ_EBZN/1p7pXICZQVkV kHq7I8hj/3Lf v0ClbtvdqBskQmNj87rFfVFZNHukWSqQG/3P D4pUKsh3VaSDwQQ68Q
Accept-Ranges: bytes
Via: 1.1 google

Ug396bet.org Domain Nameserver Information

HostIP AddressCountry
ns33.domaincontrol.com 97.74.106.17
ns34.domaincontrol.com 173.201.74.17


Need to find out who hosts Ug396bet.org?


Domain Registration (WhoIs) information for Ug396bet.org

 Domain Name: UG396BET.ORG
Registry Domain ID: D402200000012129102-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2020-02-13T03:49:38Z
Creation Date: 2019-12-14T07:21:43Z
Registry Expiry Date: 2021-12-14T07:21:43Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization:
Registrant State/Province: Wilayah Persekutuan
Registrant Country: MY
Name Server: NS33.DOMAINCONTROL.COM
Name Server: NS34.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-12-07T19:43:39Z

Websites with Similar Names

Ug396-api.com
503 Service Temporarily Unavailable
Ug396.info
Ultimate Gaming

Recently Updated Websites

Francebilletreduc.shop (3 seconds ago.)Makeoverly.com (3 seconds ago.)Triumphfp.com (5 seconds ago.)Collaboratemgmt.com (5 seconds ago.)Threeamigoscharlotte.com (5 seconds ago.)Veenasan.com (6 seconds ago.)Wgoadventures.com (6 seconds ago.)Babyfein.ch (6 seconds ago.)Kuicapital.com (6 seconds ago.)Milanolightblue.shop (8 seconds ago.)Ivettesinspirations.com (9 seconds ago.)Untobaccocontrol.org (9 seconds ago.)Homefixus.com (10 seconds ago.)Remace.supply (11 seconds ago.)Siebrenvanbruggen.com (12 seconds ago.)Mama-mi.com (12 seconds ago.)Trips-paid.com (12 seconds ago.)Grafifut.com (13 seconds ago.)Npo-okca.or.jp (13 seconds ago.)Sz-slw.com (16 seconds ago.)Themembershipinstitute.com (16 seconds ago.)Vccp.agency (16 seconds ago.)Bonzofood.com (17 seconds ago.)Jetpacq.com (17 seconds ago.)Kiddie.life (17 seconds ago.)Pastorgordon.com (17 seconds ago.)Derfreibierfred.com (17 seconds ago.)Budhersong.com (17 seconds ago.)Friendandgrant.com (18 seconds ago.)Nadler-hof.com (18 seconds ago.)

Recently Searched Keywords

personal publishing (1 second ago.)hedge trimmer (2 seconds ago.)2020 fresh updated usa it companies 120 490 email database (3 seconds ago.)辣妹有約綜藝節目 (4 seconds ago.)le plus long fleuve de france m (4 seconds ago.)recoequip (5 seconds ago.)etpbtext27 (5 seconds ago.)rusty hearts private (6 seconds ago.)margin0px importantborder000000 0px (9 seconds ago.)blue trousers8377129900 837743900add (11 seconds ago.)arcot sign on password (12 seconds ago.)automaticliftback (13 seconds ago.)weiße girls (796 live) (14 seconds ago.)tvos macos (16 seconds ago.)chacchoben tour (19 seconds ago.)my phn tch (19 seconds ago.)nerd passions (20 seconds ago.)yemoja (21 seconds ago.)u043eu043fu0442u043eu0432u044bu0439 u0441u043au043bu0430u0434 (21 seconds ago.)торговля оптовая твердым, жидким и газообразным топливом и подобными продуктами (22 seconds ago.)wedding colours themes (25 seconds ago.)resultmarkettypeid1970324836974645altmarkettypeidsnamehandicapmarkettypeid1970324836975100altmarkettypeids1970324836978002nametotalmarkettypeid1970324836974992altmarkettypeidsnamehalftimemarkettypeid1970324836974998altmarkettypeidsnamehalftime (25 seconds ago.)5 padding-bottom (25 seconds ago.)pairshellip (28 seconds ago.)wejustsmokeit (28 seconds ago.)cpsula (30 seconds ago.)pagelayer-background-overlaybackground-color (30 seconds ago.)lee stone (31 seconds ago.)room dining room (31 seconds ago.)купить ламинин (32 seconds ago.)