Ultimasnoticias.com.ve

| Últimas Noticias

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 24,472
Estimated Worth: $621,360
Last updated:2020-10-18
Category: News and Media


Domain summary

Domain label
ultimasnoticias
Domain extension
com.ve
Global Traffic Rank
24,472
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$621,360
Estimated daily income
$863
Estimated monthly income
$26,250

Rank summary

How is ultimasnoticias.com.ve ranked relative to other sites:

Percentage of visits to ultimasnoticias.com.ve from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Ultimasnoticias.com.ve registered?
A: Ultimasnoticias.com.ve was registered 1 month, 2 weeks, 4 days, 9 hours, 19 minutes, 39 seconds ago on Sunday, October 18, 2020.
Q: When was the WHOIS for Ultimasnoticias.com.ve last updated?
A: The WHOIS entry was last updated 1 month, 2 weeks, 4 days, 9 hours, 19 minutes, 39 seconds ago on Sunday, October 18, 2020.
Q: What are Ultimasnoticias.com.ve's nameservers?
A: DNS for Ultimasnoticias.com.ve is provided by the following nameservers:
  • kim.ns.cloudflare.com
  • pranab.ns.cloudflare.com
Q: Who is the registrar for the Ultimasnoticias.com.ve domain?
A: The domain has been registered at .
Q: What is the traffic rank for Ultimasnoticias.com.ve?
A: Ultimasnoticias.com.ve ranks 24,472 globally on Alexa. Ultimasnoticias.com.ve has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Ultimasnoticias.com.ve each day?
A: Ultimasnoticias.com.ve receives approximately 71,919 visitors and 431,514 page impressions per day.
Q: What IP address does Ultimasnoticias.com.ve resolve to?
A: Ultimasnoticias.com.ve resolves to the IPv4 address 104.31.93.207.
Q: In what country are Ultimasnoticias.com.ve servers located in?
A: Ultimasnoticias.com.ve has servers located in the United States.
Q: What webserver software does Ultimasnoticias.com.ve use?
A: Ultimasnoticias.com.ve is powered by CloudFlare webserver.
Q: Who hosts Ultimasnoticias.com.ve?
A: Ultimasnoticias.com.ve is hosted by TOT Public Company Limited in United States.
Q: How much is Ultimasnoticias.com.ve worth?
A: Ultimasnoticias.com.ve has an estimated worth of $621,360. An average daily income of approximately $863, which is roughly $26,250 per month.

Ultimasnoticias.com.ve Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Ultimasnoticias.com.ve Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Ultimasnoticias.com.ve

H1 Headings

0 :

H2 Headings

4 :
  1. Opinión
  2. Grandes historias
  3. Tu mascota
  4. © 2019 C.A. Últimas Noticias | RIF: J-00037398-1

H3 Headings

1 :
  1. Fito Páez en animé

H4 Headings

2 :
  1. ¡Listo!
  2. Preferencias de Privacidad

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

5 :

Total Images

92 :

Google Adsense

:
pub-0948728800350681

Google Analytics

:
UA-124669-10

Links - Internal

239:
  1. Ultimasnoticias Cartas a la dirección
    https://ultimasnoticias.com.ve/cartas-a-la-direccion/
  2. Ultimasnoticias La voz del lector
    https://ultimasnoticias.com.ve/la-voz-del-lector/
  3. Ultimasnoticias Archivo 2020
    https://ultimasnoticias.com.ve/archivo-2020-octubre/
  4. Ultimasnoticias Newsletter
    https://ultimasnoticias.com.ve/newsletter/
  5. Ultimasnoticias Coronavirus
    https://ultimasnoticias.com.ve/especial-coronavirus/
  6. Ultimasnoticias Publicidad
    https://ultimasnoticias.com.ve/comercializacion/
  7. Ultimasnoticias Banco Caroní
    https://ultimasnoticias.com.ve/noticias/balances/2157609/
  8. Ultimasnoticias Banco de Venezuela
    https://ultimasnoticias.com.ve/noticias/balances/2157817/
  9. https://ultimasnoticias.com.ve/
    https://ultimasnoticias.com.ve/
  10. Ultimasnoticias Más Vida
    https://ultimasnoticias.com.ve/mas-vida/
  11. Ultimasnoticias Aceras y brocales
    https://ultimasnoticias.com.ve/1975642-2/
  12. Ultimasnoticias SúperBarrio
    https://ultimasnoticias.com.ve/superbarrio/
  13. Ultimasnoticias Tu mascota
    https://ultimasnoticias.com.ve/tumascota/
  14. Ultimasnoticias Política
    https://ultimasnoticias.com.ve/politica/
  15. Ultimasnoticias Economía
    https://ultimasnoticias.com.ve/economia/
  16. Ultimasnoticias Sucesos
    https://ultimasnoticias.com.ve/sucesos/
  17. Ultimasnoticias Deportes
    https://ultimasnoticias.com.ve/deportes/
  18. Ultimasnoticias Opinión
    https://ultimasnoticias.com.ve/opinion/
  19. Ultimasnoticias Mundo
    https://ultimasnoticias.com.ve/mundo/
  20. Ultimasnoticias Chévere
    https://ultimasnoticias.com.ve/chevere/
  21. Ultimasnoticias Pulso Regional
    https://ultimasnoticias.com.ve/pulso-regional/
  22. Ultimasnoticias Amazonas
    https://ultimasnoticias.com.ve/amazonas/
  23. Ultimasnoticias Anzoátegui
    https://ultimasnoticias.com.ve/anzoategui/
  24. Ultimasnoticias Apure
    https://ultimasnoticias.com.ve/apure/
  25. Ultimasnoticias Aragua
    https://ultimasnoticias.com.ve/aragua/
  26. Ultimasnoticias Barinas
    https://ultimasnoticias.com.ve/barinas/
  27. Ultimasnoticias Bolívar
    https://ultimasnoticias.com.ve/bolivar/
  28. Ultimasnoticias Carabobo
    https://ultimasnoticias.com.ve/carabobo/
  29. Ultimasnoticias Cojedes
    https://ultimasnoticias.com.ve/cojedes/
  30. Ultimasnoticias Delta Amacuro
    https://ultimasnoticias.com.ve/delta-amacuro/
  31. Ultimasnoticias Falcón
    https://ultimasnoticias.com.ve/falcon/
  32. Ultimasnoticias Guárico
    https://ultimasnoticias.com.ve/guarico/
  33. Ultimasnoticias La Guaira
    https://ultimasnoticias.com.ve/la-guaira/
  34. Ultimasnoticias Lara
    https://ultimasnoticias.com.ve/lara/
  35. Ultimasnoticias Mérida
    https://ultimasnoticias.com.ve/merida/
  36. Ultimasnoticias Miranda
    https://ultimasnoticias.com.ve/miranda/
  37. Ultimasnoticias Monagas
    https://ultimasnoticias.com.ve/monagas/
  38. Ultimasnoticias Nueva Esparta
    https://ultimasnoticias.com.ve/nueva-esparta/
  39. Ultimasnoticias Portuguesa
    https://ultimasnoticias.com.ve/portuguesa/
  40. Ultimasnoticias Sucre
    https://ultimasnoticias.com.ve/sucre/
  41. Ultimasnoticias Táchira
    https://ultimasnoticias.com.ve/tachira/
  42. Ultimasnoticias Trujillo
    https://ultimasnoticias.com.ve/trujillo/
  43. Ultimasnoticias Yaracuy
    https://ultimasnoticias.com.ve/yaracuy/
  44. Ultimasnoticias Zulia
    https://ultimasnoticias.com.ve/zulia/
  45. Ultimasnoticias Bienestar
    https://ultimasnoticias.com.ve/bienestar/
  46. Ultimasnoticias Ros Feng Shui
    https://ultimasnoticias.com.ve/ros-feng-shui/
  47. Ultimasnoticias Cocina
    https://ultimasnoticias.com.ve/cocina/
  48. Ultimasnoticias English
    https://en.ultimasnoticias.com.ve
  49. Ultimasnoticias Español
    https://ultimasnoticias.com.ve
  50. Ultimasnoticias AMAZONAS
    https://ultimasnoticias.com.ve/amazonas/
  51. Ultimasnoticias ANZOÁTEGUI
    https://ultimasnoticias.com.ve/anzoategui/
  52. Ultimasnoticias APURE
    https://ultimasnoticias.com.ve/apure/
  53. Ultimasnoticias ARAGUA
    https://ultimasnoticias.com.ve/aragua/
  54. Ultimasnoticias BARINAS
    https://ultimasnoticias.com.ve/barinas/
  55. Ultimasnoticias BOLÍVAR
    https://ultimasnoticias.com.ve/bolivar/
  56. Ultimasnoticias CARABOBO
    https://ultimasnoticias.com.ve/carabobo/
  57. Ultimasnoticias COJEDES
    https://ultimasnoticias.com.ve/cojedes/
  58. Ultimasnoticias DELTA AMACURO
    https://ultimasnoticias.com.ve/delta-amacuro/
  59. Ultimasnoticias FALCÓN
    https://ultimasnoticias.com.ve/falcon/
  60. Ultimasnoticias GUÁRICO
    https://ultimasnoticias.com.ve/guarico/
  61. Ultimasnoticias LA GUAIRA
    https://ultimasnoticias.com.ve/la-guaira/
  62. Ultimasnoticias LARA
    https://ultimasnoticias.com.ve/lara/
  63. Ultimasnoticias MÉRIDA
    https://ultimasnoticias.com.ve/merida/
  64. Ultimasnoticias MIRANDA
    https://ultimasnoticias.com.ve/miranda/
  65. Ultimasnoticias MONAGAS
    https://ultimasnoticias.com.ve/monagas/
  66. Ultimasnoticias NUEVA ESPARTA
    https://ultimasnoticias.com.ve/nueva-esparta/
  67. Ultimasnoticias PORTUGUESA
    https://ultimasnoticias.com.ve/portuguesa/
  68. Ultimasnoticias SUCRE
    https://ultimasnoticias.com.ve/sucre/
  69. Ultimasnoticias TÁCHIRA
    https://ultimasnoticias.com.ve/tachira/
  70. Ultimasnoticias TRUJILLO
    https://ultimasnoticias.com.ve/trujillo/
  71. Ultimasnoticias YARACUY
    https://ultimasnoticias.com.ve/yaracuy/
  72. Ultimasnoticias ZULIA
    https://ultimasnoticias.com.ve/zulia/
  73. Ultimasnoticias El covid-19 en el mundo, datos de todos los países en tiempo real
    https://ultimasnoticias.com.ve/especial-coronavirus/
  74. https://ultimasnoticias.com.ve/cada-familia-una-escuela/
    https://ultimasnoticias.com.ve/cada-familia-una-escuela/
  75. Ultimasnoticias Descarga aquí las guías pedagógicas del Ministerio de Educación
    https://ultimasnoticias.com.ve/cada-familia-una-escuela/
  76. https://ultimasnoticias.com.ve/tumascota/
    https://ultimasnoticias.com.ve/tumascota/
  77. Ultimasnoticias Tu mascota, un espacio para las historias y los consejos 
    https://ultimasnoticias.com.ve/tumascota/
  78. https://ultimasnoticias.com.ve/newsletter/
    https://ultimasnoticias.com.ve/newsletter/
  79. Ultimasnoticias Suscríbete al newsletter y recibe en tu correo lo último del coronavirus
    https://ultimasnoticias.com.ve/newsletter/
  80. Ultimasnoticias Venezuela reporta 531 nuevos contagios por covid-19
    https://ultimasnoticias.com.ve/noticias/mas-vida/venezuela-reporta-531-nuevos-contagios-por-covid-19/
  81. https://ultimasnoticias.com.ve/noticias/especial/pandemia-final-luis-brito-garcia/
    https://ultimasnoticias.com.ve/noticias/especial/pandemia-final-luis-brito-garcia/
  82. Ultimasnoticias Pandemia final | Luis Brito García
    https://ultimasnoticias.com.ve/noticias/especial/pandemia-final-luis-brito-garcia/
  83. https://ultimasnoticias.com.ve/noticias/especial/tercera-ola-pandemica-voltea-hacia-la-psiquis/
    https://ultimasnoticias.com.ve/noticias/especial/tercera-ola-pandemica-voltea-hacia-la-psiquis/
  84. Ultimasnoticias Tercera ola pandémica voltea hacia la psiquis
    https://ultimasnoticias.com.ve/noticias/especial/tercera-ola-pandemica-voltea-hacia-la-psiquis/
  85. https://ultimasnoticias.com.ve/noticias/especial/descuento-del-encaje-legal-pasqualina-curcio/
    https://ultimasnoticias.com.ve/noticias/especial/descuento-del-encaje-legal-pasqualina-curcio/
  86. Ultimasnoticias Descuento del encaje legal | Pasqualina Curcio
    https://ultimasnoticias.com.ve/noticias/especial/descuento-del-encaje-legal-pasqualina-curcio/
  87. https://ultimasnoticias.com.ve/noticias/especial/con-la-vacuna-rusa-vuelve-el-momento-sputnik/
    https://ultimasnoticias.com.ve/noticias/especial/con-la-vacuna-rusa-vuelve-el-momento-sputnik/
  88. Ultimasnoticias Con la vacuna rusa vuelve el “momento Sputnik”
    https://ultimasnoticias.com.ve/noticias/especial/con-la-vacuna-rusa-vuelve-el-momento-sputnik/
  89. https://ultimasnoticias.com.ve/noticias/opinion/cuentos-pandemicos-luis-brito-garcia/
    https://ultimasnoticias.com.ve/noticias/opinion/cuentos-pandemicos-luis-brito-garcia/
  90. Ultimasnoticias Cuentos pandémicos | Luis Brito García
    https://ultimasnoticias.com.ve/noticias/opinion/cuentos-pandemicos-luis-brito-garcia/
  91. Ultimasnoticias Iniciarán jornada de cedulación pre-electoral
    https://ultimasnoticias.com.ve/noticias/politica/iniciaran-jornada-de-cedulacion-pre-electoral/
  92. Ultimasnoticias 17 octubre, 2020
    https://ultimasnoticias.com.ve/noticias/2020/10/17/
  93. https://ultimasnoticias.com.ve/noticias/politica/iniciaran-jornada-de-cedulacion-pre-electoral/
    https://ultimasnoticias.com.ve/noticias/politica/iniciaran-jornada-de-cedulacion-pre-electoral/
  94. https://ultimasnoticias.com.ve/noticias/destacado/guaido-reconoce-que-mandato-de-an-culmina-el-4-de-enero-de-2021/
    https://ultimasnoticias.com.ve/noticias/destacado/guaido-reconoce-que-mandato-de-an-culmina-el-4-de-enero-de-2021/
  95. Ultimasnoticias Guaidó reconoce que mandato de AN culmina el 4 de enero de 2021
    https://ultimasnoticias.com.ve/noticias/destacado/guaido-reconoce-que-mandato-de-an-culmina-el-4-de-enero-de-2021/
  96. https://ultimasnoticias.com.ve/noticias/destacado/poder-judicial-critico-dos-investigaciones-del-ministerio-publico/
    https://ultimasnoticias.com.ve/noticias/destacado/poder-judicial-critico-dos-investigaciones-del-ministerio-publico/
  97. Ultimasnoticias Poder Judicial criticó dos investigaciones del Ministerio Público
    https://ultimasnoticias.com.ve/noticias/destacado/poder-judicial-critico-dos-investigaciones-del-ministerio-publico/
  98. https://ultimasnoticias.com.ve/noticias/mundo/morales-suspension-de-conteo-preliminar-pone-en-duda-sus-intenciones/
    https://ultimasnoticias.com.ve/noticias/mundo/morales-suspension-de-conteo-preliminar-pone-en-duda-sus-intenciones/
  99. Ultimasnoticias Morales: suspensión de conteo preliminar pone en duda sus intenciones
    https://ultimasnoticias.com.ve/noticias/mundo/morales-suspension-de-conteo-preliminar-pone-en-duda-sus-intenciones/
  100. Ultimasnoticias 18 octubre, 2020
    https://ultimasnoticias.com.ve/noticias/2020/10/18/
  101. https://ultimasnoticias.com.ve/noticias/mas-vida/deteccion-temprana-ofrece-mas-oportunidad-de-vencer/
    https://ultimasnoticias.com.ve/noticias/mas-vida/deteccion-temprana-ofrece-mas-oportunidad-de-vencer/
  102. Ultimasnoticias “Detección temprana ofrece más oportunidad de vencer”
    https://ultimasnoticias.com.ve/noticias/mas-vida/deteccion-temprana-ofrece-mas-oportunidad-de-vencer/
  103. https://ultimasnoticias.com.ve/noticias/sucesos/llevaban-100-panelas-de-marihuana-en-tres-cauchos/
    https://ultimasnoticias.com.ve/noticias/sucesos/llevaban-100-panelas-de-marihuana-en-tres-cauchos/
  104. Ultimasnoticias Llevaban 100 panelas de marihuana en tres cauchos
    https://ultimasnoticias.com.ve/noticias/sucesos/llevaban-100-panelas-de-marihuana-en-tres-cauchos/
  105. https://ultimasnoticias.com.ve/noticias/mundo/evo-morales-denuncia-amenazas-contra-veedores-de-comicios-en-bolivia/
    https://ultimasnoticias.com.ve/noticias/mundo/evo-morales-denuncia-amenazas-contra-veedores-de-comicios-en-bolivia/
  106. Ultimasnoticias Evo Morales denuncia amenazas contra veedores de comicios en Bolivia
    https://ultimasnoticias.com.ve/noticias/mundo/evo-morales-denuncia-amenazas-contra-veedores-de-comicios-en-bolivia/
  107. https://ultimasnoticias.com.ve/noticias/mundo/mujeres-de-eeuu-protestan-en-rechazo-a-politicas-de-trump/
    https://ultimasnoticias.com.ve/noticias/mundo/mujeres-de-eeuu-protestan-en-rechazo-a-politicas-de-trump/
  108. Ultimasnoticias Mujeres de EEUU protestan en rechazo a políticas de Trump
    https://ultimasnoticias.com.ve/noticias/mundo/mujeres-de-eeuu-protestan-en-rechazo-a-politicas-de-trump/
  109. https://ultimasnoticias.com.ve/noticias/politica/juramentan-comando-de-campana-dario-vivas-en-la-zona-oeste-de-monagas/
    https://ultimasnoticias.com.ve/noticias/politica/juramentan-comando-de-campana-dario-vivas-en-la-zona-oeste-de-monagas/
  110. Ultimasnoticias Juramentan Comando de Campaña Darío Vivas en la zona oeste de Monagas
    https://ultimasnoticias.com.ve/noticias/politica/juramentan-comando-de-campana-dario-vivas-en-la-zona-oeste-de-monagas/
  111. https://ultimasnoticias.com.ve/noticias/general/en-antioquia-colombia-asesinan-a-otro-lider-social/
    https://ultimasnoticias.com.ve/noticias/general/en-antioquia-colombia-asesinan-a-otro-lider-social/
  112. Ultimasnoticias En Antioquia Colombia asesinan a otro líder social
    https://ultimasnoticias.com.ve/noticias/general/en-antioquia-colombia-asesinan-a-otro-lider-social/
  113. https://ultimasnoticias.com.ve/noticias/general/capturado-militar-por-golpear-a-su-pareja/
    https://ultimasnoticias.com.ve/noticias/general/capturado-militar-por-golpear-a-su-pareja/
  114. Ultimasnoticias Capturado militar por golpear a su pareja
    https://ultimasnoticias.com.ve/noticias/general/capturado-militar-por-golpear-a-su-pareja/
  115. https://ultimasnoticias.com.ve/noticias/general/venezuela-saluda-a-argentina-en-dia-de-la-lealtad/
    https://ultimasnoticias.com.ve/noticias/general/venezuela-saluda-a-argentina-en-dia-de-la-lealtad/
  116. Ultimasnoticias Venezuela saluda a Argentina en Día de la Lealtad
    https://ultimasnoticias.com.ve/noticias/general/venezuela-saluda-a-argentina-en-dia-de-la-lealtad/
  117. https://ultimasnoticias.com.ve/noticias/general/onu-ue-y-la-iglesia-catolica-llaman-a-bolivianos-a-votar-en-paz/
    https://ultimasnoticias.com.ve/noticias/general/onu-ue-y-la-iglesia-catolica-llaman-a-bolivianos-a-votar-en-paz/
  118. Ultimasnoticias ONU, UE y la Iglesia Católica llaman a bolivianos a votar en paz
    https://ultimasnoticias.com.ve/noticias/general/onu-ue-y-la-iglesia-catolica-llaman-a-bolivianos-a-votar-en-paz/
  119. https://ultimasnoticias.com.ve/noticias/general/banda-de-el-peru-asesino-a-un-hombre/
    https://ultimasnoticias.com.ve/noticias/general/banda-de-el-peru-asesino-a-un-hombre/
  120. Ultimasnoticias Banda de El Perú asesinó a un hombre
    https://ultimasnoticias.com.ve/noticias/general/banda-de-el-peru-asesino-a-un-hombre/
  121. https://ultimasnoticias.com.ve/noticias/general/alcaldesa-wisely-alvarez-dio-positivo-a-covid-19/
    https://ultimasnoticias.com.ve/noticias/general/alcaldesa-wisely-alvarez-dio-positivo-a-covid-19/
  122. Ultimasnoticias Alcaldesa Wisely Álvarez dio positivo a covid-19
    https://ultimasnoticias.com.ve/noticias/general/alcaldesa-wisely-alvarez-dio-positivo-a-covid-19/
  123. https://ultimasnoticias.com.ve/noticias/general/distribuyen-4-mil-bombonas-de-gas-para-atender-demanda-en-monagas/
    https://ultimasnoticias.com.ve/noticias/general/distribuyen-4-mil-bombonas-de-gas-para-atender-demanda-en-monagas/
  124. Ultimasnoticias Distribuyen 4 mil bombonas de gas para atender demanda en Monagas
    https://ultimasnoticias.com.ve/noticias/general/distribuyen-4-mil-bombonas-de-gas-para-atender-demanda-en-monagas/
  125. https://ultimasnoticias.com.ve/noticias/general/chile-vuelve-a-las-calles-a-dias-del-aniversario-del-estallido-social/
    https://ultimasnoticias.com.ve/noticias/general/chile-vuelve-a-las-calles-a-dias-del-aniversario-del-estallido-social/
  126. Ultimasnoticias Chile vuelve a las calles a días del aniversario del estallido social
    https://ultimasnoticias.com.ve/noticias/general/chile-vuelve-a-las-calles-a-dias-del-aniversario-del-estallido-social/
  127. https://ultimasnoticias.com.ve/noticias/general/alcaldia-de-caroni-sanciono-a-comerciantes-informales/
    https://ultimasnoticias.com.ve/noticias/general/alcaldia-de-caroni-sanciono-a-comerciantes-informales/
  128. Ultimasnoticias Alcaldía de Caroní sancionó a comerciantes informales
    https://ultimasnoticias.com.ve/noticias/general/alcaldia-de-caroni-sanciono-a-comerciantes-informales/
  129. https://ultimasnoticias.com.ve/noticias/general/inameh-preve-precipitaciones-de-intensidad-variable/
    https://ultimasnoticias.com.ve/noticias/general/inameh-preve-precipitaciones-de-intensidad-variable/
  130. Ultimasnoticias Inameh prevé precipitaciones de intensidad variable
    https://ultimasnoticias.com.ve/noticias/general/inameh-preve-precipitaciones-de-intensidad-variable/
  131. https://ultimasnoticias.com.ve/noticias/general/detuvieron-a-tres-personas-con-299-municiones/
    https://ultimasnoticias.com.ve/noticias/general/detuvieron-a-tres-personas-con-299-municiones/
  132. Ultimasnoticias Detuvieron a tres personas con 299 municiones
    https://ultimasnoticias.com.ve/noticias/general/detuvieron-a-tres-personas-con-299-municiones/
  133. https://ultimasnoticias.com.ve/noticias/general/adolescente-asesino-a-su-abuela-de-multiples-punaladas/
    https://ultimasnoticias.com.ve/noticias/general/adolescente-asesino-a-su-abuela-de-multiples-punaladas/
  134. Ultimasnoticias Adolescente asesinó a su abuela de múltiples puñaladas
    https://ultimasnoticias.com.ve/noticias/general/adolescente-asesino-a-su-abuela-de-multiples-punaladas/
  135. https://ultimasnoticias.com.ve/noticias/general/silmaca-elevara-produccion-alimentaria-con-nueva-linea-industrial/
    https://ultimasnoticias.com.ve/noticias/general/silmaca-elevara-produccion-alimentaria-con-nueva-linea-industrial/
  136. Ultimasnoticias Silmaca elevará producción alimentaria con nueva línea industrial
    https://ultimasnoticias.com.ve/noticias/general/silmaca-elevara-produccion-alimentaria-con-nueva-linea-industrial/
  137. https://ultimasnoticias.com.ve/noticias/mas-vida/oms-la-dexametasona-es-el-unico-farmaco-eficaz/
    https://ultimasnoticias.com.ve/noticias/mas-vida/oms-la-dexametasona-es-el-unico-farmaco-eficaz/
  138. Ultimasnoticias OMS: La dexametasona es el único fármaco eficaz
    https://ultimasnoticias.com.ve/noticias/mas-vida/oms-la-dexametasona-es-el-unico-farmaco-eficaz/
  139. https://ultimasnoticias.com.ve/noticias/general/argentina-exige-a-anez-responsabilidad-por-detencion-de-diputado/
    https://ultimasnoticias.com.ve/noticias/general/argentina-exige-a-anez-responsabilidad-por-detencion-de-diputado/
  140. Ultimasnoticias Argentina exige a Añez responsabilidad por detención de diputado
    https://ultimasnoticias.com.ve/noticias/general/argentina-exige-a-anez-responsabilidad-por-detencion-de-diputado/
  141. https://ultimasnoticias.com.ve/noticias/general/aragua-recibe-maquinaria-para-reforzar-atencion-por-lluvias/
    https://ultimasnoticias.com.ve/noticias/general/aragua-recibe-maquinaria-para-reforzar-atencion-por-lluvias/
  142. Ultimasnoticias Aragua recibe maquinaria para reforzar atención por lluvias
    https://ultimasnoticias.com.ve/noticias/general/aragua-recibe-maquinaria-para-reforzar-atencion-por-lluvias/
  143. https://ultimasnoticias.com.ve/noticias/pulso/sector-mujer-y-comunicacion-como-maquinaria-politica-en-guarico/
    https://ultimasnoticias.com.ve/noticias/pulso/sector-mujer-y-comunicacion-como-maquinaria-politica-en-guarico/
  144. Ultimasnoticias Sector mujer y comunicación como maquinaria política en Guárico
    https://ultimasnoticias.com.ve/noticias/pulso/sector-mujer-y-comunicacion-como-maquinaria-politica-en-guarico/
  145. https://ultimasnoticias.com.ve/noticias/general/pandemia-en-ee-uu-deja-mas-hispanos-y-afrodescendientes-pobres/
    https://ultimasnoticias.com.ve/noticias/general/pandemia-en-ee-uu-deja-mas-hispanos-y-afrodescendientes-pobres/
  146. Ultimasnoticias Pandemia en EE.UU. deja más hispanos y afrodescendientes pobres
    https://ultimasnoticias.com.ve/noticias/general/pandemia-en-ee-uu-deja-mas-hispanos-y-afrodescendientes-pobres/
  147. https://ultimasnoticias.com.ve/noticias/especial/el-oficial-persigue-al-criminal-o-este-hala-al-oficial-y-se-lo-vacila/
    https://ultimasnoticias.com.ve/noticias/especial/el-oficial-persigue-al-criminal-o-este-hala-al-oficial-y-se-lo-vacila/
  148. Ultimasnoticias ¿El oficial persigue al criminal o éste hala al oficial y se lo vacila? | Pasqualina Curcio
    https://ultimasnoticias.com.ve/noticias/especial/el-oficial-persigue-al-criminal-o-este-hala-al-oficial-y-se-lo-vacila/
  149. https://ultimasnoticias.com.ve/negocios
    https://ultimasnoticias.com.ve/negocios
  150. https://ultimasnoticias.com.ve/noticias/negocios/clases-en-linea-llenas-de-sabor/
    https://ultimasnoticias.com.ve/noticias/negocios/clases-en-linea-llenas-de-sabor/
  151. Ultimasnoticias Clases en línea llenas de sabor
    https://ultimasnoticias.com.ve/noticias/negocios/clases-en-linea-llenas-de-sabor/
  152. Ultimasnoticias 14 octubre, 2020
    https://ultimasnoticias.com.ve/noticias/2020/10/14/
  153. https://ultimasnoticias.com.ve/noticias/tecnologia/apple-presenta-su-altavoz-homepod-mini/
    https://ultimasnoticias.com.ve/noticias/tecnologia/apple-presenta-su-altavoz-homepod-mini/
  154. Ultimasnoticias Apple presenta su altavoz HomePod mini
    https://ultimasnoticias.com.ve/noticias/tecnologia/apple-presenta-su-altavoz-homepod-mini/
  155. https://ultimasnoticias.com.ve/noticias/tecnologia/apple-presenta-nuevos-iphones-para-las-redes-5g-mas-rapidas/
    https://ultimasnoticias.com.ve/noticias/tecnologia/apple-presenta-nuevos-iphones-para-las-redes-5g-mas-rapidas/
  156. Ultimasnoticias Apple presenta nuevos iPhones para las redes 5G más rápidas
    https://ultimasnoticias.com.ve/noticias/tecnologia/apple-presenta-nuevos-iphones-para-las-redes-5g-mas-rapidas/
  157. Ultimasnoticias 13 octubre, 2020
    https://ultimasnoticias.com.ve/noticias/2020/10/13/
  158. https://ultimasnoticias.com.ve/noticias/negocios/mercado-envios-una-solucion-logistica-para-vendedores-de-e-commerce/
    https://ultimasnoticias.com.ve/noticias/negocios/mercado-envios-una-solucion-logistica-para-vendedores-de-e-commerce/
  159. Ultimasnoticias Mercado Envíos: una solución logística para vendedores de e-commerce
    https://ultimasnoticias.com.ve/noticias/negocios/mercado-envios-una-solucion-logistica-para-vendedores-de-e-commerce/
  160. https://ultimasnoticias.com.ve/noticias/negocios/voluntarios-de-fundacion-movistar-realizaron-jornadas-sociales/
    https://ultimasnoticias.com.ve/noticias/negocios/voluntarios-de-fundacion-movistar-realizaron-jornadas-sociales/
  161. Ultimasnoticias Voluntarios de Fundación Movistar realizaron jornadas sociales
    https://ultimasnoticias.com.ve/noticias/negocios/voluntarios-de-fundacion-movistar-realizaron-jornadas-sociales/
  162. Ultimasnoticias 4 octubre, 2020
    https://ultimasnoticias.com.ve/noticias/2020/10/04/
  163. https://ultimasnoticias.com.ve/noticias/negocios/farmatodo-y-loreal-paris-aliados-en-la-lucha-contra-el-cancer-de-mama/
    https://ultimasnoticias.com.ve/noticias/negocios/farmatodo-y-loreal-paris-aliados-en-la-lucha-contra-el-cancer-de-mama/
  164. Ultimasnoticias Farmatodo y L’Oreal Paris aliados en la lucha contra el cáncer de mama
    https://ultimasnoticias.com.ve/noticias/negocios/farmatodo-y-loreal-paris-aliados-en-la-lucha-contra-el-cancer-de-mama/
  165. Ultimasnoticias 3 octubre, 2020
    https://ultimasnoticias.com.ve/noticias/2020/10/03/
  166. https://ultimasnoticias.com.ve/noticias/general/venezuela-lanza-su-propia-bolsa-descentralizada-de-valores-basada-en-ethereum/
    https://ultimasnoticias.com.ve/noticias/general/venezuela-lanza-su-propia-bolsa-descentralizada-de-valores-basada-en-ethereum/
  167. Ultimasnoticias Venezuela lanza su propia bolsa descentralizada de valores basada en Ethereum
    https://ultimasnoticias.com.ve/noticias/general/venezuela-lanza-su-propia-bolsa-descentralizada-de-valores-basada-en-ethereum/
  168. Ultimasnoticias 2 octubre, 2020
    https://ultimasnoticias.com.ve/noticias/2020/10/02/
  169. https://ultimasnoticias.com.ve/noticias/negocios/grano-de-cafe-venezolano-triunfo-en-singapur/
    https://ultimasnoticias.com.ve/noticias/negocios/grano-de-cafe-venezolano-triunfo-en-singapur/
  170. Ultimasnoticias Grano de café venezolano triunfó en Singapur
    https://ultimasnoticias.com.ve/noticias/negocios/grano-de-cafe-venezolano-triunfo-en-singapur/
  171. Ultimasnoticias 1 octubre, 2020
    https://ultimasnoticias.com.ve/noticias/2020/10/01/
  172. https://ultimasnoticias.com.ve/noticias/negocios/banco-del-tesoro-amplia-canales-electronicos-para-facilitar-operaciones/
    https://ultimasnoticias.com.ve/noticias/negocios/banco-del-tesoro-amplia-canales-electronicos-para-facilitar-operaciones/
  173. Ultimasnoticias Banco del Tesoro amplía canales electrónicos para facilitar operaciones
    https://ultimasnoticias.com.ve/noticias/negocios/banco-del-tesoro-amplia-canales-electronicos-para-facilitar-operaciones/
  174. Ultimasnoticias 30 septiembre, 2020
    https://ultimasnoticias.com.ve/noticias/2020/09/30/
  175. Ultimasnoticias Fito Páez en animé
    https://ultimasnoticias.com.ve/noticias/video/gilberto-santa-rosa-le-canta-a-la-familia/
  176. Ultimasnoticias Luis Britto García
    https://ultimasnoticias.com.ve/noticias/author/lbritto/
  177. Ultimasnoticias Bruno Renaud
    https://ultimasnoticias.com.ve/noticias/author/brenaud/
  178. Ultimasnoticias Un santo “nuevo estilo”
    https://ultimasnoticias.com.ve/noticias/opinion/un-santo-nuevo-estilo/
  179. Ultimasnoticias Raúl Cazal
    https://ultimasnoticias.com.ve/noticias/author/racazal/
  180. Ultimasnoticias El pavor a la democracia
    https://ultimasnoticias.com.ve/noticias/opinion/el-pavor-a-la-democracia/
  181. Ultimasnoticias Agustín Blanco Muñoz
    https://ultimasnoticias.com.ve/noticias/author/ablanco/
  182. Ultimasnoticias Un mundo muerto
    https://ultimasnoticias.com.ve/noticias/opinion/un-mundo-muerto/
  183. Ultimasnoticias Jesús A. Rondón
    https://ultimasnoticias.com.ve/noticias/author/jrondon/
  184. Ultimasnoticias Entre la fe y el sujeto
    https://ultimasnoticias.com.ve/noticias/opinion/entre-la-fe-y-el-sujeto/
  185. Ultimasnoticias Earle Herrera
    https://ultimasnoticias.com.ve/noticias/author/eherrera/
  186. Ultimasnoticias Generación del bloqueo
    https://ultimasnoticias.com.ve/noticias/opinion/generacion-del-bloqueo/
  187. Ultimasnoticias Eduardo Fernández
    https://ultimasnoticias.com.ve/noticias/author/efernandez/
  188. Ultimasnoticias Gracias a la vida
    https://ultimasnoticias.com.ve/noticias/opinion/gracias-a-la-vida/
  189. Ultimasnoticias Aurora Lacueva
    https://ultimasnoticias.com.ve/noticias/author/alacueva/
  190. Ultimasnoticias Votar: por paz y democracia
    https://ultimasnoticias.com.ve/noticias/opinion/votar-por-paz-y-democracia/
  191. https://ultimasnoticias.com.ve/noticias/historias/el-evangelio-segun-mafalda/
    https://ultimasnoticias.com.ve/noticias/historias/el-evangelio-segun-mafalda/
  192. Ultimasnoticias El evangelio según Mafalda
    https://ultimasnoticias.com.ve/noticias/historias/el-evangelio-segun-mafalda/
  193. https://ultimasnoticias.com.ve/noticias/deportes/tampa-detuvo-la-remontada-sideral-y-avanzo-a-la-serie-mundial/
    https://ultimasnoticias.com.ve/noticias/deportes/tampa-detuvo-la-remontada-sideral-y-avanzo-a-la-serie-mundial/
  194. Ultimasnoticias Tampa detuvo la remontada sideral y avanzó a la Serie Mundial
    https://ultimasnoticias.com.ve/noticias/deportes/tampa-detuvo-la-remontada-sideral-y-avanzo-a-la-serie-mundial/
  195. https://ultimasnoticias.com.ve/noticias/deportes/dodgers-obligan-al-septimo-con-joya-de-walker-buehler/
    https://ultimasnoticias.com.ve/noticias/deportes/dodgers-obligan-al-septimo-con-joya-de-walker-buehler/
  196. Ultimasnoticias Dodgers obligan al séptimo con joya de Walker Buehler
    https://ultimasnoticias.com.ve/noticias/deportes/dodgers-obligan-al-septimo-con-joya-de-walker-buehler/
  197. https://ultimasnoticias.com.ve/noticias/deportes/michael-carrera-jugara-la-superliga-con-supersonicos-de-miranda/
    https://ultimasnoticias.com.ve/noticias/deportes/michael-carrera-jugara-la-superliga-con-supersonicos-de-miranda/
  198. Ultimasnoticias Michael Carrera jugará la Superliga con Supersónicos de Miranda
    https://ultimasnoticias.com.ve/noticias/deportes/michael-carrera-jugara-la-superliga-con-supersonicos-de-miranda/
  199. https://ultimasnoticias.com.ve/noticias/deportes/el-cadiz-logra-una-historica-victoria-ante-el-real-madrid/
    https://ultimasnoticias.com.ve/noticias/deportes/el-cadiz-logra-una-historica-victoria-ante-el-real-madrid/
  200. Ultimasnoticias El Cádiz logra una histórica victoria ante el Real Madrid
    https://ultimasnoticias.com.ve/noticias/deportes/el-cadiz-logra-una-historica-victoria-ante-el-real-madrid/
  201. https://ultimasnoticias.com.ve/noticias/deportes/yangel-fue-letal-ante-el-sevilla/
    https://ultimasnoticias.com.ve/noticias/deportes/yangel-fue-letal-ante-el-sevilla/
  202. Ultimasnoticias Yangel fue letal ante el Sevilla
    https://ultimasnoticias.com.ve/noticias/deportes/yangel-fue-letal-ante-el-sevilla/
  203. https://ultimasnoticias.com.ve/noticias/deportes/habra-septimo-los-astros-empataron-la-serie/
    https://ultimasnoticias.com.ve/noticias/deportes/habra-septimo-los-astros-empataron-la-serie/
  204. Ultimasnoticias ¡Habrá séptimo! Los Astros empataron la serie
    https://ultimasnoticias.com.ve/noticias/deportes/habra-septimo-los-astros-empataron-la-serie/
  205. Ultimasnoticias 16 octubre, 2020
    https://ultimasnoticias.com.ve/noticias/2020/10/16/
  206. Ultimasnoticias Chévere
    https://ultimasnoticias.com.ve/seccion/chevere/
  207. https://ultimasnoticias.com.ve/noticias/chevere/residente-pone-en-pausa-la-musica-para-hacer-cine-y-tv/
    https://ultimasnoticias.com.ve/noticias/chevere/residente-pone-en-pausa-la-musica-para-hacer-cine-y-tv/
  208. Ultimasnoticias Residente pone en pausa la música para hacer cine y TV
    https://ultimasnoticias.com.ve/noticias/chevere/residente-pone-en-pausa-la-musica-para-hacer-cine-y-tv/
  209. https://ultimasnoticias.com.ve/noticias/chevere/un-bandido-honrado-intentara-cambiar-de-vida/
    https://ultimasnoticias.com.ve/noticias/chevere/un-bandido-honrado-intentara-cambiar-de-vida/
  210. Ultimasnoticias «Un bandido honrado» intentará cambiar de vida
    https://ultimasnoticias.com.ve/noticias/chevere/un-bandido-honrado-intentara-cambiar-de-vida/
  211. https://ultimasnoticias.com.ve/noticias/chevere/jagged-little-pill-recibio-15-nominaciones-al-tony/
    https://ultimasnoticias.com.ve/noticias/chevere/jagged-little-pill-recibio-15-nominaciones-al-tony/
  212. Ultimasnoticias Jagged Little Pill recibió 15 nominaciones al Tony
    https://ultimasnoticias.com.ve/noticias/chevere/jagged-little-pill-recibio-15-nominaciones-al-tony/
  213. https://ultimasnoticias.com.ve/noticias/chevere/el-boricua-guaynaa-le-canta-a-las-chamas/
    https://ultimasnoticias.com.ve/noticias/chevere/el-boricua-guaynaa-le-canta-a-las-chamas/
  214. Ultimasnoticias El boricua Guaynaa le canta a las chamas
    https://ultimasnoticias.com.ve/noticias/chevere/el-boricua-guaynaa-le-canta-a-las-chamas/
  215. https://ultimasnoticias.com.ve/noticias/chevere/polanski-honra-a-familia-que-lo-salvo-del-holocausto/
    https://ultimasnoticias.com.ve/noticias/chevere/polanski-honra-a-familia-que-lo-salvo-del-holocausto/
  216. Ultimasnoticias Polanski honra a familia que lo salvó del Holocausto
    https://ultimasnoticias.com.ve/noticias/chevere/polanski-honra-a-familia-que-lo-salvo-del-holocausto/
  217. https://ultimasnoticias.com.ve/noticias/chevere/guillermo-carrasco-la-musica-cambio/
    https://ultimasnoticias.com.ve/noticias/chevere/guillermo-carrasco-la-musica-cambio/
  218. Ultimasnoticias Guillermo Carrasco “La música cambió”
    https://ultimasnoticias.com.ve/noticias/chevere/guillermo-carrasco-la-musica-cambio/
  219. https://ultimasnoticias.com.ve/noticias/chevere/ozuna-presenta-su-video-del-mar-junto-a-doja-car-y-sia/
    https://ultimasnoticias.com.ve/noticias/chevere/ozuna-presenta-su-video-del-mar-junto-a-doja-car-y-sia/
  220. Ultimasnoticias Ozuna presenta su video «Del Mar» junto a Doja Car y Sia
    https://ultimasnoticias.com.ve/noticias/chevere/ozuna-presenta-su-video-del-mar-junto-a-doja-car-y-sia/
  221. https://ultimasnoticias.com.ve/noticias/bienestar/el-pan-alrededor-del-mundo/
    https://ultimasnoticias.com.ve/noticias/bienestar/el-pan-alrededor-del-mundo/
  222. Ultimasnoticias El pan alrededor del mundo
    https://ultimasnoticias.com.ve/noticias/bienestar/el-pan-alrededor-del-mundo/
  223. https://ultimasnoticias.com.ve/noticias/fengshui/el-bano-en-equilibrio-quedateencasa/
    https://ultimasnoticias.com.ve/noticias/fengshui/el-bano-en-equilibrio-quedateencasa/
  224. Ultimasnoticias El baño en equilibrio #QuédateenCasa
    https://ultimasnoticias.com.ve/noticias/fengshui/el-bano-en-equilibrio-quedateencasa/
  225. https://ultimasnoticias.com.ve/noticias/cocina/albondigas-en-salsa-casera/
    https://ultimasnoticias.com.ve/noticias/cocina/albondigas-en-salsa-casera/
  226. Ultimasnoticias Albóndigas en salsa casera
    https://ultimasnoticias.com.ve/noticias/cocina/albondigas-en-salsa-casera/
  227. https://ultimasnoticias.com.ve/noticias/tu-mascota/la-perrita-miranda-dejo-un-vacio-en-el-area-de-busqueda-y-rescate/
    https://ultimasnoticias.com.ve/noticias/tu-mascota/la-perrita-miranda-dejo-un-vacio-en-el-area-de-busqueda-y-rescate/
  228. Ultimasnoticias La perrita Miranda dejó un vacío en el área de búsqueda y rescate
    https://ultimasnoticias.com.ve/noticias/tu-mascota/la-perrita-miranda-dejo-un-vacio-en-el-area-de-busqueda-y-rescate/
  229. https://ultimasnoticias.com.ve/noticias/tu-mascota/mision-nevado-impulsa-se-incluyan-sanciones-penales-en-nueva-ley-proteccionista/
    https://ultimasnoticias.com.ve/noticias/tu-mascota/mision-nevado-impulsa-se-incluyan-sanciones-penales-en-nueva-ley-proteccionista/
  230. Ultimasnoticias Misión Nevado impulsa se incluyan sanciones penales en nueva ley proteccionista
    https://ultimasnoticias.com.ve/noticias/tu-mascota/mision-nevado-impulsa-se-incluyan-sanciones-penales-en-nueva-ley-proteccionista/
  231. https://ultimasnoticias.com.ve/noticias/pulso/aragua/bomberos-de-aragua-rescatan-a-un-perro-atrapado-tras-inundaciones/
    https://ultimasnoticias.com.ve/noticias/pulso/aragua/bomberos-de-aragua-rescatan-a-un-perro-atrapado-tras-inundaciones/
  232. Ultimasnoticias Bomberos de Aragua rescatan a un perro atrapado tras inundaciones
    https://ultimasnoticias.com.ve/noticias/pulso/aragua/bomberos-de-aragua-rescatan-a-un-perro-atrapado-tras-inundaciones/
  233. https://ultimasnoticias.com.ve/noticias/tu-mascota/rescatan-y-liberan-a-un-ejemplar-de-oso-melero-en-carabobo/
    https://ultimasnoticias.com.ve/noticias/tu-mascota/rescatan-y-liberan-a-un-ejemplar-de-oso-melero-en-carabobo/
  234. Ultimasnoticias Rescatan y liberan a un ejemplar de Oso Melero en Carabobo
    https://ultimasnoticias.com.ve/noticias/tu-mascota/rescatan-y-liberan-a-un-ejemplar-de-oso-melero-en-carabobo/
  235. https://ultimasnoticias.com.ve/el-podcast-de-ultimas-noticias
    https://ultimasnoticias.com.ve/el-podcast-de-ultimas-noticias
  236. https://ultimasnoticias.com.ve/noticias/horoscopo/horoscopo/
    https://ultimasnoticias.com.ve/noticias/horoscopo/horoscopo/
  237. Ultimasnoticias Redacción
    https://ultimasnoticias.com.ve/redaccion/
  238. Ultimasnoticias Privacidad
    https://ultimasnoticias.com.ve/politica-de-privacidad/
  239. Ultimasnoticias Política de Cookies
    https://ultimasnoticias.com.ve/politica-de-cookies

Links - Internal (nofollow)

0:

Links - Outbound

10:
  1. https://t.me/unoticias
    https://t.me/unoticias
  2. https://www.facebook.com/ultimasnoticiasve/
    https://www.facebook.com/ultimasnoticiasve/
  3. https://www.instagram.com/unoticias/?hl=es-la
    https://www.instagram.com/unoticias/?hl=es-la
  4. https://twitter.com/UNoticias
    https://twitter.com/UNoticias
  5. https://www.youtube.com/c/%C3%9AltimasNoticiasDiario
    https://www.youtube.com/c/%C3%9AltimasNoticiasDiario
  6. https://public.flourish.studio/visualisation/1916832/?utm_source=embed&utm_campaign=visualisation/1916832
    https://public.flourish.studio/visualisation/1916832/?utm_source=embed&utm_campaign=visualisation/1916832
  7. https://public.flourish.studio/visualisation/1917423/?utm_source=embed&utm_campaign=visualisation/1917423
    https://public.flourish.studio/visualisation/1917423/?utm_source=embed&utm_campaign=visualisation/1917423
  8. http://www.liderendeportes.com/
    http://www.liderendeportes.com/
  9. https://editorialsber.com
    https://editorialsber.com
  10. https://twitter.com/mundohipicoUN
    https://twitter.com/mundohipicoUN

Links - Outbound (nofollow)

0:

Keyword Cloud for Ultimasnoticias.com.ve

mlformembedwrapper mlformembedbody mlforminterestgroupsrow300x250mlformhorizontalrowfunction ifelementorelementelementorelementb3acdf5mlforminterestgroupsrowcheckboxelsemlformembedwrapper mlformembedbodymlformembedbody mlformhorizontalrow customcheckboxelementorimagelabeldescriptionbeforetop0importantboxsizingborderboximportantmlb22633621mlformembedcontainer mlformembedwrapper mlformembedbodymlformfieldrow customcheckbox customcontrollabelbeforemlb22633621mlformembedcontainercustomradio customcontrollabelbeforemlb22633621mlformembedcontainertrue300u00d7250customcontrolinputcheckedcustomcontrollabelbeforemlb22633621mlformembedcontainer mlformembedwrapper mlformembedbodyreturnunlabelgrandes1 elseif1 else vardocument readywindowadvancedadsreadymlformembedpermissionsoptionscheckbox labeldescriptionbeforemlb22633621mlformembedcontainer mlformembedwrapperlaspmlforminterestgroupsrow mlforminterestgroupsrowcheckboxmlformembedwrapper mlformembedbody mlformhorizontalrowstickywaitforimagestime stickywaitforimagestimeadvancedadsstickyitemsmlformembedbody mlformembedpermissions mlformembedpermissionsoptionscheckboxcustomcontrollabelaftermlb22633621mlformembedcontainernull function ifmlformembedwrappermlformcheckboxrow labeldescriptionbeforemlb22633621mlformembedcontainermlformembedbody mlformembedsubmitadvadscfpadmslabeldescriptionaftermlb22633621mlformembedcontainerready callnuevafinalultim68542782wrapperdatafinal luis britomlformembedbody mlformembedpermissionsmlformcheckboxrow labeldescriptionaftermlb22633621mlformembedcontainer mlformembedwrapperpasqualina curciovenezuelasidebarlabeldescriptionaftermlb22633621mlformembedcontainer mlformembedwrapper mlformembedbodywrapperidmlformsuccessbody mlformsuccesscontentmlformembedwrapper mlformembedbody mlformembedcontentmlformcheckboxrow labeldescriptionaftermlb22633621mlformembedcontainercustomcontrollabelbeforemlb22633621mlformembedcontainer mlformembedwrapper0 20pxwindowadsbygoogle push new2customcheckbox customcontrollabelaftermlb22633621mlformembedcontainer mlformembedwrapper1mlformembedbody mlformfieldrow customcheckbox10pxmlformhorizontalrow customcheckbox customcontrollabelbeforemlb22633621mlformembedcontainerparleyreadycustomcontrollabelaftermlb22633621mlformembedcontainer mlformembedwrapper0pxdelmlformembedpermissionsoptionscheckbox labeldescriptionbeforemlb22633621mlformembedcontainertarifasnotapublicidadimportantelementorwidgetcontainermargin0px 0pxn advancedadsstickyitemscustomcontrolinputmlb22633621mlformembedcontainerwindowadvancedadsstickyitemsmirandaconstitucion brandingpush new advadscfpadmlformembedsubmitaraguacustomcontrollabelaftermlb22633621mlformembedcontainer mlformembedwrapper mlformembedbodyporlabeldescriptionbeforemlb22633621mlformembedcontainer mlformembedwrapper mlformembedbody0 10pxcustomcheckbox customcontrollabelbeforemlb22633621mlformembedcontainerluis britomlformembedwrapper mlformsuccessbodycustomcontrollabelmlb22633621mlformembedcontainer mlformembedwrapper mlformembedbodymlformembedpermissionsadvancedadsstickyitems ultim367670569mlformembedpermissions mlformembedpermissionsoptionscheckbox labeldescriptionbeforemlb22633621mlformembedcontainerwrapperdata stickywaitforimagestime stickywaitforimagestimewrapperdata stickywaitforimagestimelabeldescriptionbeforemlb22633621mlformembedcontainertu correoconmlformembedbody mlformcheckboxrow labelcall nullready call nullwrapper jquerypublicidad adsbygoogle windowadsbygooglestickywaitforimagestime stickywaitforimagestime nmascotaelementorwidgetcontainermargin0pxoctubre 2020else varalcustomradio customcontrollabelbeforemlb22633621mlformembedcontainer mlformembedwrapperjquery documentcallcurciotuultim367670569labeldescriptionaftermlb22633621mlformembedcontainer mlformembedwrapperluis brito garcacustomcontrollabelmlb22633621mlformembedcontainer mlformembedwrappercustomcheckbox customcontrollabelbeforemlb22633621mlformembedcontainer mlformembedwrapperjquery document readygarcahistoriaslotoencimalabeldescriptionbeforetop0importantboxsizingborderboximportantmlb22633621mlformembedcontainer mlformembedwrappery20pxadvadsgetcookiemlformembedcontentmlforminterestgroupsrowmlformembedbody mlforminterestgroupsrow mlforminterestgroupsrowcheckboxvar advancedadsadimpressions2009826stickywaitforimagestimelabeldescriptionsuperiorlabeldescriptionbeforetop0importantboxsizingborderboximportantmlb22633621mlformembedcontainermlformembedwrapper mlformembedbody mlformfieldrowmlformembedbody mlformcheckboxrowcustomcontrollabelbeforemlb22633621mlformembedcontainer mlformembedwrapper mlformembedbodymlformfieldrow customradiocustomcontrollabelbeforemlb22633621mlformembedcontainercorreodocumenttu parleyadvancedadsadimpressions2009829customcheckboxmlformembedbodypmlb22633621mlformembedcontainerquepush newmundofunctionmlformembedbody mlformcheckboxrow labeldescriptionbeforemlb22633621mlformembedcontainerif advadsgetcookieelnwindowadsbygoogleoctubreluismlformsuccesscontentadvadswaitforimages0nullnewcustomcontrolinputmlb22633621mlformembedcontainer mlformembedwrapper mlformembedbodypasqualinavuelve3mlformembedwrapper mlformembedbody mlformembedsubmittu mascotamu00f3viladsadvancedadsstickyitems ultim68542782varbrito garcapushcustomcontrolinputcheckedcustomcontrollabelbeforemlb22633621mlformembedcontaineradsbygoogle windowadsbygoogle pushpu00e1rrafomlformembedbody mlformfieldrow customradiocoronavirusmlformembedbody mlformfieldrowjquerymlformembedbody mlformcheckboxrow labeldescriptionaftermlb22633621mlformembedcontainermlformfieldrowmlformhorizontalrow customradiomlformembedpermissionsoptionscheckboxwindowadsbygoogle pushpublicidad adsbygooglelabeldescriptionbeforemlb22633621mlformembedcontainer mlformembedwrapperdocument ready callwindowadvancedadsready jquery documentconstitucionbrandingsucustomcheckbox customcontrollabelaftermlb22633621mlformembedcontainerbritovar advancedadsadimpressions2009829sabersewrappermlformembedwrapper mlformembedbody mlformcheckboxroweditorialfinal luismlformembedbody mlformembedcontentadsbygoogle windowadsbygooglemlformembedwrapper mlformsuccessbody mlformsuccesscontentbancomlformhorizontalrow customcheckboxcustomcontrolinputcheckedcustomcontrollabelbeforemlb22633621mlformembedcontainer mlformembedwrappercustomcontrolinputmlb22633621mlformembedcontainer mlformembedwrappernew advadscfpadmlformembedwrapper mlformembedbody mlformembedpermissionsplangnull functionmlformcheckboxrownewsletter320x100editorial sabermlformembedbody mlformhorizontalrowloselementorwidgetcontainermargin0px 0px 0pxmlformcheckboxrow labelbillboardmlformsuccessbodymlformfieldrow customcheckboxmlformembedbody mlforminterestgroupsrowpandemiaeselementorelementelementorelemente020f4bcall null functionmlformcheckboxrow labeldescriptionbeforemlb22633621mlformembedcontainer mlformembedwrapperadsbygooglemlformembedpermissions mlformembedpermissionsoptionscheckboxcustomcontrollabelmlb22633621mlformembedcontainerlowindowadvancedadsready jqueryadvancedadsadimpressions2009826presenta0px 0pxstickywaitforimagestime npara4solidmlformembedbody mlformhorizontalrow customradiocustomradio

Longtail Keyword Density for Ultimasnoticias.com.ve

KeywordsOccurences
ml-form-embedwrapper ml-form-embedbody ml-form-horizontalrow24
ml-form-embedwrapper ml-form-embedbody ml-form-fieldrow24
ml-form-embedwrapper ml-form-embedbody ml-form-checkboxrow17
ml-form-embedwrapper ml-form-embedbody ml-form-embedpermissions9
ml-form-embedbody ml-form-embedpermissions ml-form-embedpermissionsoptionscheckbox9
publicidad adsbygoogle windowadsbygoogle9
adsbygoogle windowadsbygoogle push9
windowadsbygoogle push new9
push new advadscfpad9
custom-control-labelbeforemlb2-2633621ml-form-embedcontainer ml-form-embedwrapper ml-form-embedbody9
ml-form-embedwrapper ml-form-embedbody ml-form-interestgroupsrow8
ml-form-embedbody ml-form-fieldrow custom-checkbox8
ml-form-embedbody ml-form-horizontalrow custom-checkbox8
ml-form-embedbody ml-form-interestgroupsrow ml-form-interestgroupsrowcheckbox8
label-descriptionbeforemlb2-2633621ml-form-embedcontainer ml-form-embedwrapper ml-form-embedbody7
ml-form-embedbody ml-form-fieldrow custom-radio7
ml-form-embedbody ml-form-horizontalrow custom-radio6
ml-form-embedwrapper ml-form-embedbody ml-form-embedcontent6
custom-checkbox custom-control-labelbeforemlb2-2633621ml-form-embedcontainer ml-form-embedwrapper6
ml-form-embedwrapper ml-form-successbody ml-form-successcontent6
jquery document ready5
document ready call5
ready call null5
windowadvancedadsready jquery document5
luis brito garca5
label-descriptionaftermlb2-2633621ml-form-embedcontainer ml-form-embedwrapper ml-form-embedbody5
custom-control-labelaftermlb2-2633621ml-form-embedcontainer ml-form-embedwrapper ml-form-embedbody5
call null function5
1 else var4
wrapperdata stickywaitforimagestime stickywaitforimagestime4
stickywaitforimagestime stickywaitforimagestime n4
custom-control-inputcheckedcustom-control-labelbeforemlb2-2633621ml-form-embedcontainer ml-form-embedwrapper ml-form-embedbody4
ml-form-embedbody ml-form-checkboxrow label-descriptionbeforemlb2-2633621ml-form-embedcontainer4
ml-form-checkboxrow label-descriptionbeforemlb2-2633621ml-form-embedcontainer ml-form-embedwrapper4
custom-checkbox custom-control-labelaftermlb2-2633621ml-form-embedcontainer ml-form-embedwrapper3
elementor-widget-containermargin0px 0px 0px3
null function if3
ml-form-embedpermissions ml-form-embedpermissionsoptionscheckbox label-descriptionbeforemlb2-2633621ml-form-embedcontainer3
ml-form-embedpermissionsoptionscheckbox label-descriptionbeforemlb2-2633621ml-form-embedcontainer ml-form-embedwrapper3
ml-form-fieldrow custom-checkbox custom-control-labelbeforemlb2-2633621ml-form-embedcontainer3
ml-form-embedwrapper ml-form-embedbody ml-form-embedsubmit3
custom-radio custom-control-labelbeforemlb2-2633621ml-form-embedcontainer ml-form-embedwrapper3
ml-form-embedbody ml-form-checkboxrow label3
custom-control-labelmlb2-2633621ml-form-embedcontainer ml-form-embedwrapper ml-form-embedbody3
custom-control-inputmlb2-2633621ml-form-embedcontainer ml-form-embedwrapper ml-form-embedbody3
label-descriptionbeforetop0importantbox-sizingborder-boximportantmlb2-2633621ml-form-embedcontainer ml-form-embedwrapper ml-form-embedbody3
ml-form-horizontalrow custom-checkbox custom-control-labelbeforemlb2-2633621ml-form-embedcontainer3
ml-form-checkboxrow label-descriptionaftermlb2-2633621ml-form-embedcontainer ml-form-embedwrapper3
ml-form-embedbody ml-form-checkboxrow label-descriptionaftermlb2-2633621ml-form-embedcontainer3
final luis brito3
ml-form-embedwrapper ml-form-embedbody108
octubre 202050
ml-form-embedbody ml-form-fieldrow24
ml-form-embedbody ml-form-horizontalrow24
ml-form-embedbody ml-form-checkboxrow17
windowadsbygoogle push11
new advadscfpad11
ml-form-embedbody ml-form-embedpermissions9
custom-control-labelbeforemlb2-2633621ml-form-embedcontainer ml-form-embedwrapper9
ml-form-embedpermissions ml-form-embedpermissionsoptionscheckbox9
adsbygoogle windowadsbygoogle9
publicidad adsbygoogle9
push new9
ml-form-horizontalrow custom-checkbox8
ml-form-fieldrow custom-checkbox8
ml-form-embedbody ml-form-interestgroupsrow8
ml-form-interestgroupsrow ml-form-interestgroupsrowcheckbox8
ml-form-fieldrow custom-radio7
ml-form-embedwrapper ml-form-successbody7
label-descriptionbeforemlb2-2633621ml-form-embedcontainer ml-form-embedwrapper7
custom-checkbox custom-control-labelbeforemlb2-2633621ml-form-embedcontainer6
ml-form-horizontalrow custom-radio6
ml-form-successbody ml-form-successcontent6
ml-form-embedbody ml-form-embedcontent6
jquery document5
custom-control-labelaftermlb2-2633621ml-form-embedcontainer ml-form-embedwrapper5
document ready5
windowadvancedadsready jquery5
editorial saber5
ready call5
call null5
brito garca5
null function5
luis brito5
label-descriptionaftermlb2-2633621ml-form-embedcontainer ml-form-embedwrapper5
tu parley4
constitucion branding4
if advadsgetcookie4
wrapperdata stickywaitforimagestime4
1 else4
ml-form-checkboxrow label-descriptionbeforemlb2-2633621ml-form-embedcontainer4
else var4
wrapper jquery4
n advancedadsstickyitems4
stickywaitforimagestime n4
stickywaitforimagestime stickywaitforimagestime4
0 20px4
custom-control-inputcheckedcustom-control-labelbeforemlb2-2633621ml-form-embedcontainer ml-form-embedwrapper4
var advancedadsadimpressions20098263
var advancedadsadimpressions20098293
function if3
advancedadsstickyitems ultim-685427823
tu mascota3
ml-form-embedbody ml-form-embedsubmit3
ml-form-checkboxrow label3
custom-control-labelmlb2-2633621ml-form-embedcontainer ml-form-embedwrapper3
custom-control-inputmlb2-2633621ml-form-embedcontainer ml-form-embedwrapper3
label-descriptionbeforetop0importantbox-sizingborder-boximportantmlb2-2633621ml-form-embedcontainer ml-form-embedwrapper3
ml-form-checkboxrow label-descriptionaftermlb2-2633621ml-form-embedcontainer3
custom-checkbox custom-control-labelaftermlb2-2633621ml-form-embedcontainer3
tu correo3
custom-radio custom-control-labelbeforemlb2-2633621ml-form-embedcontainer3
ml-form-embedpermissionsoptionscheckbox label-descriptionbeforemlb2-2633621ml-form-embedcontainer3
0 10px3
0px 0px3
elementor-widget-containermargin0px 0px3
pasqualina curcio3
final luis3
advancedadsstickyitems ultim-3676705693
ml-form-embedwrapper121
ml-form-embedbody108
octubre54
053
ml-form-horizontalrow30
ml-form-fieldrow24
advadscfpad21
el20
n19
function18
var18
del18
custom-checkbox17
y17
ml-form-checkboxrow17
custom-radio14
new13
push11
mu00f3vil11
windowadsbygoogle11
stickywaitforimagestime10
publicidad10
tu10
adsbygoogle9
19
jquery9
ml-form-embedpermissions9
ml-form-embedpermissionsoptionscheckbox9
if9
custom-control-labelbeforemlb2-2633621ml-form-embedcontainer9
28
ml-form-interestgroupsrowcheckbox8
ml-form-interestgroupsrow8
constitucion8
0px8
ml-form-successbody7
con7
para7
320x1007
label-descriptionbeforemlb2-2633621ml-form-embedcontainer7
por7
ml-form-embedcontent6
ml-form-successcontent6
superior6
advancedadsadimpressions20098266
advadsgetcookie6
else6
wrapper6
ultim-3676705696
advancedadsadimpressions20098296
un6
advancedadsstickyitems6
luis6
ultim-685427826
label-descriptionaftermlb2-2633621ml-form-embedcontainer5
custom-control-labelaftermlb2-2633621ml-form-embedcontainer5
las5
al5
editorial5
brito5
garca5
saber5
important5
ready5
20px5
ms5
null5
windowadvancedadsready5
call5
su5
document5
300u00d72504
pu00e1rrafo4
encima4
billboard4
branding4
wrapperid4
wrapperdata4
advadswaitforimages4
parley4
windowadvancedadsstickyitems4
coronavirus4
34
aragua4
label-description4
nueva4
mundo4
plang4
custom-control-inputcheckedcustom-control-labelbeforemlb2-2633621ml-form-embedcontainer4
elementor-image4
banco4
elementor-elementelementor-element-e020f4b4
10px4
venezuela4
los4
historias3
final3
pandemia3
lo3
correo3
mascota3
ads3
curcio3
es3
tarifas3
300x2503
sidebar3
nota3
pasqualina3
presenta3
vuelve3
miranda3
true3
label3
return3
custom-control-labelmlb2-2633621ml-form-embedcontainer3
custom-control-inputmlb2-2633621ml-form-embedcontainer3
label-descriptionbeforetop0importantbox-sizingborder-boximportantmlb2-2633621ml-form-embedcontainer3
newsletter3
p3
que3
pmlb2-2633621ml-form-embedcontainer3
solid3
elementor-widget-containermargin0px3
elementor-elementelementor-element-b3acdf53
43
grandes3
ml-form-embedsubmit3
se3
loto3

Who hosts Ultimasnoticias.com.ve?

Ultimasnoticias.com.ve Hosting Provider Information

Hosted IP Address:104.31.93.207
Hosted Hostname:104.31.93.207
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "TOT Public Company Limited" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Ultimasnoticias.com.ve

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sun, 18 Oct 2020 07:31:01 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Location: https://ultimasnoticias.com.ve/
CF-Cache-Status: DYNAMIC
cf-request-id: 05dc377fed000007a29b0a8000000001
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?lkg-colo=21&lkg-time=1603006262"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5e408eacad0907a2-LHR

Ultimasnoticias.com.ve Domain Nameserver Information

HostIP AddressCountry
kim.ns.cloudflare.com 108.162.192.126
pranab.ns.cloudflare.com 162.159.44.199


Need to find out who hosts Ultimasnoticias.com.ve?


Domain Registration (WhoIs) information for Ultimasnoticias.com.ve

 % Servidor whois del Centro de Información de Red de Venezuela (NIC.VE)
% Este servidor contiene información autoritativa exclusivamente de dominios .ve
%
% Whoisd Server Version: 3.12.1
% Timestamp: Sun Oct 18 03:31:03 2020

domain: ultimasnoticias.com.ve
registrant: CON000007508
admin-c: CON000007508
nsset: DNS000117490
registrar: NIC-VE
registered: 12.08.1999 20:00:00
changed: 16.12.2019 08:58:56
expire: 15.11.2020

contact: CON000007508
org: C.a. Ultimas Noticias
address: La Urbina
address: Caracas
address: 1073
address: Distrito Capital
address: VE
registrar: NIC-VE
created: 04.08.2019 13:05:32
changed: 21.05.2020 08:19:33

nsset: DNS000117490
nserver: kim.ns.cloudflare.com
nserver: pranab.ns.cloudflare.com
tech-c: CON000007508
registrar: NIC-VE
created: 16.12.2019 08:58:44
changed: 21.05.2020 08:41:53

Websites with Similar Names

Ultim-host.fr
Ultim Host - Cheap DMCA Ignored Hosting
Ultim-immo.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Ultim-zone.in
Ultim-Zone
Ultim8-souliers.com
Vente de chaussures et Accessoires de mode - ULTIM'8 SOULIERS
Ultim8.pl
ultim8.pl - studio grafiki użytkowej / graphic design studio

Recently Updated Websites

Artudaipur.com (4 minutes 6 seconds ago.)Thomas-dopatka.de (17 minutes 17 seconds ago.)Maquinaproduccion.com (17 minutes 24 seconds ago.)Minicowtriclub.com (17 minutes 47 seconds ago.)Labusinesscard.com (17 minutes 49 seconds ago.)Fawnblakelyrealestate.com (17 minutes 57 seconds ago.)Costartees.com (18 minutes 3 seconds ago.)Toledomedia.com (18 minutes 5 seconds ago.)Cookinglib.ru (18 minutes 6 seconds ago.)6969movie.com (18 minutes 13 seconds ago.)Speakfromday1.com (18 minutes 13 seconds ago.)Yilishuang.com (18 minutes 14 seconds ago.)Amom.net (18 minutes 15 seconds ago.)Susevo.com (18 minutes 16 seconds ago.)Tiny-turnings.com (18 minutes 19 seconds ago.)Houghton.edu (18 minutes 20 seconds ago.)Desiloans.com (18 minutes 21 seconds ago.)Gotdiamonds.net (18 minutes 25 seconds ago.)Mainvuehomes.com (18 minutes 26 seconds ago.)Reemsaleh.com (18 minutes 26 seconds ago.)Mtbakerbikeclub.org (18 minutes 28 seconds ago.)Dallasoishii.com (18 minutes 29 seconds ago.)Perthblinds.com (18 minutes 32 seconds ago.)Shribrijyatra.com (18 minutes 33 seconds ago.)Thedarbotz.com (18 minutes 37 seconds ago.)Wescom.org (18 minutes 39 seconds ago.)68locust.info (18 minutes 42 seconds ago.)Engstromengstrom.com (18 minutes 42 seconds ago.)Terzisepeti.com (18 minutes 45 seconds ago.)Makinghealthyez.com (18 minutes 52 seconds ago.)

Recently Searched Keywords

лунтик (1 second ago.)data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid (1 second ago.)insta-baby (3 seconds ago.)safely (10 seconds ago.)4 (11 seconds ago.)hã¼tten (12 seconds ago.)geile blondine (14 seconds ago.)pelatihan (14 seconds ago.)全方位的展现国内外体坛风云 (20 seconds ago.)everything you need (21 seconds ago.)lihat semua new arrival po (31 seconds ago.)nisan 16 (35 seconds ago.)oldies (40 seconds ago.)gold bracelet design (44 seconds ago.)chuckanut 50k (44 seconds ago.)i have the confidence of a chicken nugget (44 seconds ago.)new sheila holland, holland (45 seconds ago.)chuckanut feline center (45 seconds ago.)copyright ul (46 seconds ago.)got diamonds by the boatload lyrics (46 seconds ago.)httpsstaticwebsgurucomarvarm33737b1961582174324-logo-aab32pngv7345002 (47 seconds ago.)mais informaes (48 seconds ago.)metscon (50 seconds ago.)203 graffiti (51 seconds ago.)standwithtexaspac (52 seconds ago.)zenzele bricks contact (52 seconds ago.)pilieromazza youtube (53 seconds ago.)zentangle bricks (54 seconds ago.)08 divpreloader (1 minute ago.)making healthy (1 minute 1 second ago.)