UNHCR - The UN Refugee Agency

Safety: High trust score
Year Founded: 1997
Global Traffic Rank: 2,337
Estimated Worth: $6,913,080

UNHCR, the UN Refugee Agency, is a global organisation dedicated to saving lives and protecting the rights of refugees, forcibly displaced communities and stateless people. Visit our website and find out how you can support us.



Domain summary

Last updated
2022-01-29
Domain label
unhcr
Domain extension
org
Domain registered:
1997-04-05
Domain updated:
2022-01-29
Global Traffic Rank
2,337
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$6,913,080
Estimated daily income
$6,401
Estimated monthly income
$194,697

Frequently Asked Questions (FAQ)

Q: When was Unhcr.org registered?
A: Unhcr.org was registered 25 years, 1 month, 1 week, 5 days, 34 minutes, 2 seconds ago on Saturday, April 5, 1997.
Q: When was the WHOIS for Unhcr.org last updated?
A: The WHOIS entry was last updated 3 months, 2 weeks, 5 days, 34 minutes, 2 seconds ago on Saturday, January 29, 2022.
Q: What are Unhcr.org's nameservers?
A: DNS for Unhcr.org is provided by the following nameservers:
  • ns-1127.awsdns-12.org
  • ns-1747.awsdns-26.co.uk
  • ns-399.awsdns-49.com
  • ns-808.awsdns-37.net
Q: Who is the registrar for the Unhcr.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Unhcr.org?
A: Unhcr.org ranks 2,337 globally on Alexa. Unhcr.org has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Unhcr.org each day?
A: Unhcr.org receives approximately 800,171 visitors and 6,401,368 page impressions per day.
Q: What IP address does Unhcr.org resolve to?
A: Unhcr.org resolves to the IPv4 address .
Q: In what country are Unhcr.org servers located in?
A: Unhcr.org has servers located in the .
Q: What webserver software does Unhcr.org use?
A: Unhcr.org is powered by CloudFlare webserver.
Q: Who hosts Unhcr.org?
A: Unhcr.org is hosted by Unknown in .
Q: How much is Unhcr.org worth?
A: Unhcr.org has an estimated worth of $6,913,080. An average daily income of approximately $6,401, which is roughly $194,697 per month.

Unhcr.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Unhcr.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Unhcr.org

H1 Headings

3 :
  1. Scholarships in Italy allow refugees to dream again
  2. Schoolteachers in Honduras face threats inside the classroom and out
  3. UNHCR seeks US$59.6 million for 100,000 displaced by violence in Cameroon's Far North region

H2 Headings

14 :
  1. Services for Refugees
  2. Jordan issues record number of work permits to Syrian refugees
  3. Deteriorating conditions putting Eritrean refugees at grave risk in Tigray
  4. Donate and support displaced families this winter
  5. Winter Appeal
  6. £50
  7. £75
  8. £173
  9. Around UNHCR
  10. Information for refugees, asylum-seekers and stateless persons
  11. UNHCR's Mid-Year Trends report
  12. Afghanistan on the Brink
  13. Holiday gifts, handcrafted by refugees
  14. A time-saving way to stay on top of displacement news

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

16 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

109:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Unhcr.org

sign upsituationdeutschdonateinformationyourstayukcentresiteusrefugeejordanpartnersmedianederlandsfamiliesstoriesreportcentralgetasylumrefugeesdisplacedweyouourcouldglobalfamilyemergencyviewneedasianbspespaolunhcrsearchdoafghanistanmedia centrefranaisnewshelpwinterenglishsignupselectrepublicunited

Who hosts Unhcr.org?

Unhcr.org Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:CloudFlare

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%

HTTP Header Analysis for Unhcr.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 29 Jan 2022 05:46:24 GMT
Content-Type: text/html; charset=UTF-8
Connection: close
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 6d5028ecbd6b406c-LHR
Content-Encoding: gzip

Unhcr.org Domain Nameserver Information

HostIP AddressCountry
ns-1127.awsdns-12.org 205.251.196.103
ns-1747.awsdns-26.co.uk 205.251.198.211
ns-399.awsdns-49.com 205.251.193.143
ns-808.awsdns-37.net 205.251.195.40


Need to find out who hosts Unhcr.org?


Domain Registration (WhoIs) information for Unhcr.org

 Domain Name: UNHCR.ORG
Registry Domain ID: D402546-LROR
Registrar WHOIS Server: whois.directnic.com
Registrar URL: http://www.directnic.com
Updated Date: 2017-05-28T09:15:20Z
Creation Date: 1997-05-04T04:00:00Z
Registry Expiry Date: 2024-05-05T04:00:00Z
Registrar Registration Expiration Date:
Registrar: DNC Holdings, Inc.
Registrar IANA ID: 291
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8778569598
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: UNHCR
Registrant State/Province: GE
Registrant Country: CH
Name Server: NS-1127.AWSDNS-12.ORG
Name Server: NS-1747.AWSDNS-26.CO.UK
Name Server: NS-399.AWSDNS-49.COM
Name Server: NS-808.AWSDNS-37.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-22T04:29:37Z

Websites with Similar Names

Unhcr-arabic.org
المفوضية - المفوضية السامية للأمم المتحدة لشؤون اللاجئين
Unhcr-centraleurope.org
UNHCR Central Europe
Unhcr-droitsenfants.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Unhcr-phapps.org
Page Not Found
Unhcr-unispourelles.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Unhcr-unispourelles.org
Félicitations ! Votre domaine a bien été créé chez OVH !
Unhcr-wfp-hub.org
Home - WFP-UNHCR Joint Hub
Unhcr.ba
Default Parallels Plesk Panel Page
Unhcr.ch
UNHCR Schweiz und Liechtenstein
Unhcr.cz
UNHCR Česká republika

Recently Updated Websites

Effectiveperformancenetwork.com (1 hour 12 minutes ago.)Latest-554270.funuzai.ru (1 hour 12 minutes ago.)Confident-liskov-0781fc.netlify.app (1 hour 30 minutes ago.)Di7stero.com (1 hour 30 minutes ago.)Hdpornogratis.xxx (1 hour 31 minutes ago.)Satta-king-fast.com (2 hours 9 minutes ago.)Hellabyte.cloud (2 hours 15 minutes ago.)Abyss.to (2 hours 15 minutes ago.)Webdownload.net (2 hours 16 minutes ago.)Sattaking-no.com (2 hours 27 minutes ago.)Sattaking-up.com (2 hours 29 minutes ago.)Fre-skate-lesson.site (2 hours 43 minutes ago.)Make.com (2 hours 53 minutes ago.)Factoriacultural.es (3 hours 4 minutes ago.)Numanzia.com (3 hours 9 minutes ago.)Nftcode-it.com (3 hours 15 minutes ago.)Gurugamer.com (3 hours 21 minutes ago.)Satta-kingn.in (3 hours 27 minutes ago.)Z1fm.online (3 hours 43 minutes ago.)Fesehatk.com (4 hours 2 minutes ago.)Ntinews.com (4 hours 11 minutes ago.)Blumble.com (5 hours 19 minutes ago.)Klamboe.com (6 hours 36 minutes ago.)Boot-upstrongintenselytheproduct.vip (6 hours 43 minutes ago.)Cacheeye.com (7 hours 22 minutes ago.)Sattaking-result.com (8 hours 18 minutes ago.)Sattanom.in (8 hours 20 minutes ago.)Ghostbookwriting.services (8 hours 20 minutes ago.)Satta-king.online (8 hours 22 minutes ago.)Sattaking-number.com (8 hours 23 minutes ago.)

Recently Searched Keywords

shall it meaning in urdu (1 second ago.)lstbc (2 seconds ago.)raffinate (3 seconds ago.)-ms-linear-gradienttop rgba0 (3 seconds ago.)piotr jacek odchodzi z sokoĺ‚a ostrăłda (4 seconds ago.)etsy united kingdom (4 seconds ago.)call this function (4 seconds ago.)warriors seth curry (5 seconds ago.)manteau noir long (5 seconds ago.)your journey starts here (5 seconds ago.)lightly battered (5 seconds ago.)instrumentos complejos y (6 seconds ago.)cuisines tendances actuelles (6 seconds ago.)gratuite partir (7 seconds ago.)raffinata e (8 seconds ago.)shared (9 seconds ago.)raffinata (10 seconds ago.)veter peremen scorpions (11 seconds ago.)11 oct 2016 (11 seconds ago.)block-title-wrapblock-title-border-2 title (11 seconds ago.)irritable bowel syndrome diet (12 seconds ago.)radosĺ‚aw cielemä™cki zawodnikiem wisĺ‚y pĺ‚ock (13 seconds ago.)fortuner 2800 cc (14 seconds ago.)travis edward (15 seconds ago.)citrus heights garbage (15 seconds ago.)radosĺ‚aw bella asystentem trenera miedzi (16 seconds ago.)memory training (18 seconds ago.)sh-1111 (18 seconds ago.)tzfangnuo.com (19 seconds ago.)personaccedi (19 seconds ago.)