/
Checking...UNHCR - The UN Refugee Agency
Safety: High trust score
Year Founded: 1997
Global Traffic Rank: 2,337
Estimated Worth: $6,913,080
UNHCR, the UN Refugee Agency, is a global organisation dedicated to saving lives and protecting the rights of refugees, forcibly displaced communities and stateless people. Visit our website and find out how you can support us.
Useful Searches
unhcr
,unhcr dubai
,unhcr jobs
,unhcr abu dhabi
,unhcr meaning
,unhcr dubai office
,unhcr logo
,unhcr lebanon
,unhcr canada
,unhcr yemen
,Domain summary
| Last updated | 2022-01-29 |
| Domain label | unhcr |
| Domain extension | org |
| Domain registered: | 1997-04-05 |
| Domain updated: | 2022-01-29 |
| Global Traffic Rank | 2,337 |
| Statvoo Rating | B |
| Trust Score | High trust score |
| Estimated worth | $6,913,080 |
| Estimated daily income | $6,401 |
| Estimated monthly income | $194,697 |
Frequently Asked Questions (FAQ)
Q: When was Unhcr.org registered?
A: Unhcr.org was registered 25 years, 1 month, 1 week, 5 days, 34 minutes, 2 seconds ago on Saturday, April 5, 1997.
Q: When was the WHOIS for Unhcr.org last updated?
A: The WHOIS entry was last updated 3 months, 2 weeks, 5 days, 34 minutes, 2 seconds ago on Saturday, January 29, 2022.
Q: What are Unhcr.org's nameservers?
A: DNS for Unhcr.org is provided by the following nameservers:
- ns-1127.awsdns-12.org
- ns-1747.awsdns-26.co.uk
- ns-399.awsdns-49.com
- ns-808.awsdns-37.net
Q: Who is the registrar for the Unhcr.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Unhcr.org?
A: Unhcr.org ranks 2,337 globally on Alexa. Unhcr.org has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Unhcr.org each day?
A: Unhcr.org receives approximately 800,171 visitors and 6,401,368 page impressions per day.
Q: What IP address does Unhcr.org resolve to?
A: Unhcr.org resolves to the IPv4 address .
Q: In what country are Unhcr.org servers located in?
A: Unhcr.org has servers located in the .
Q: What webserver software does Unhcr.org use?
A: Unhcr.org is powered by CloudFlare webserver.
Q: Who hosts Unhcr.org?
A: Unhcr.org is hosted by Unknown in .
Q: How much is Unhcr.org worth?
A: Unhcr.org has an estimated worth of $6,913,080. An average daily income of approximately $6,401, which is roughly $194,697 per month.
Unhcr.org Reviews
Unhcr.org Free SEO Report
Website Related Search Terms
Website Inpage Analysis for Unhcr.org
H1 Headings
3 :- Scholarships in Italy allow refugees to dream again
- Schoolteachers in Honduras face threats inside the classroom and out
- UNHCR seeks US$59.6 million for 100,000 displaced by violence in Cameroon's Far North region
H2 Headings
14 :- Services for Refugees
- Jordan issues record number of work permits to Syrian refugees
- Deteriorating conditions putting Eritrean refugees at grave risk in Tigray
- Donate and support displaced families this winter
- Winter Appeal
- £50
- £75
- £173
- Around UNHCR
- Information for refugees, asylum-seekers and stateless persons
- UNHCR's Mid-Year Trends report
- Afghanistan on the Brink
- Holiday gifts, handcrafted by refugees
- A time-saving way to stay on top of displacement news
H3 Headings
0 :H4 Headings
0 :H5 Headings
0 :H6 Headings
0 :Total IFRAMEs
1 :Total Images
16 :Google Adsense
:Not Applicable
Google Analytics
:Not Applicable
Links - Internal
109:- https://www.unhcr.org/uk/
https://www.unhcr.org/uk/ - Unhcr Donate
https://donate.unhcr.org/gb/general/ - Unhcr Do you need help?
https://help.unhcr.org/?utm_source=unhcr.org&utm_medium=referral&utm_campaign=HQ_HE_EN_orghelp___dynh - Unhcr English
https://www.unhcr.org - Unhcr Français
https://www.unhcr.org/fr/ - Unhcr عربي
https://www.unhcr.org/ar/ - Unhcr Media centre
https://www.unhcr.org/uk/media-centre.html - Unhcr Data
https://www.unhcr.org/uk/data.html - Unhcr Supply Chain
https://www.unhcr.org/uk/doing-business.html - Unhcr Careers
https://www.unhcr.org/uk/careers.html - Unhcr About Us
https://www.unhcr.org/uk/about-us.html - Unhcr Figures at a Glance
https://www.unhcr.org/uk/figures-at-a-glance.html - Unhcr The High Commissioner
https://www.unhcr.org/uk/the-high-commissioner.html - Unhcr Who We Help
https://www.unhcr.org/uk/who-we-help.html - Unhcr Where We Work
https://www.unhcr.org/uk/where-we-work.html - Unhcr History of UNHCR
https://www.unhcr.org/uk/history-of-unhcr.html - Unhcr Nansen Refugee Award
https://www.unhcr.org/uk/nansen-refugee-award.html - Unhcr The 1951 Refugee Convention
https://www.unhcr.org/uk/1951-refugee-convention.html - Unhcr Governance and Oversight
https://www.unhcr.org/uk/governance.html - Unhcr Prominent Supporters
https://www.unhcr.org/uk/prominent-supporters.html - Unhcr Evaluation Service
https://www.unhcr.org/uk/evaluation-service.html - Unhcr Emergencies
https://www.unhcr.org/uk/emergencies.html - Unhcr Afghanistan emergency
https://www.unhcr.org/uk/afghanistan-emergency.html - Unhcr Ethiopia Tigray emergency
https://www.unhcr.org/uk/ethiopia-tigray-emergency.html - Unhcr Burundi situation
https://www.unhcr.org/uk/burundi-situation.html - Unhcr Coronavirus outbreak
https://www.unhcr.org/uk/coronavirus-covid-19.html - Unhcr Central African Republic situation
https://www.unhcr.org/uk/central-african-republic-situation.html - Unhcr DR Congo emergency
https://www.unhcr.org/uk/dr-congo-emergency.html - Unhcr Displacement in Central America
https://www.unhcr.org/uk/displacement-in-central-america.html - Unhcr Nigeria emergency
https://www.unhcr.org/uk/nigeria-emergency.html - Unhcr Rohingya emergency
https://www.unhcr.org/uk/rohingya-emergency.html - Unhcr Sahel emergency
https://www.unhcr.org/uk/sahel-emergency.html - Unhcr South Sudan emergency
https://www.unhcr.org/uk/south-sudan-emergency.html - Unhcr Syria emergency
https://www.unhcr.org/uk/syria-emergency.html - Unhcr Venezuela situation
https://www.unhcr.org/uk/venezuela-emergency.html - Unhcr Yemen emergency
https://www.unhcr.org/uk/yemen-emergency.html - Unhcr What We Do
https://www.unhcr.org/uk/what-we-do.html - Unhcr UNHCR UK information and links on Afghanistan Situation
https://www.unhcr.org/uk/unhcr-uk-information-and-links-on-afghanistan-situation.html - Unhcr The Nationality and Borders Bill
https://www.unhcr.org/uk/uk-immigration-and-asylum-plans-some-questions-answered-by-unhcr.html - Unhcr UNHCR UK FAQs on COVID-19 in Relation to Refugees and Asylum Seekers
https://www.unhcr.org/uk/unhcr-uk-faqs-on-covid-19-in-relation-to-refugees-and-asylum-seekers.html - Unhcr The Global Compact on Refugees
https://www.unhcr.org/uk/the-global-compact-on-refugees.html - Unhcr Tackling sexual exploitation, abuse and harassment
https://www.unhcr.org/uk/our-fight-against-sexual-exploitation-abuse-and-harassment.html - Unhcr Frequently asked questions for asylum seekers and refugees in the UK
https://www.unhcr.org/uk/frequently-asked-questions-for-asylum-seekers-and-refugees-in-the-uk.html - Unhcr Advocacy
https://www.unhcr.org/uk/advocacy.html - Unhcr Asylum and Migration
https://www.unhcr.org/uk/asylum-and-migration.html - Unhcr Cash-Based Interventions
https://www.unhcr.org/uk/cash-based-interventions.html - Unhcr Coordinating Assistance
https://www.unhcr.org/uk/coordinating-assistance.html - Unhcr Education
https://www.unhcr.org/uk/education.html - Unhcr Ending Statelessness
https://www.unhcr.org/uk/ending-statelessness.html - Unhcr Environment, Disasters and Climate Change
https://www.unhcr.org/uk/environment-disasters-and-climate-change.html - Unhcr Innovation
https://www.unhcr.org/uk/innovation.html - Unhcr Livelihoods and Economic Inclusion
https://www.unhcr.org/uk/livelihoods.html - Unhcr Protection
https://www.unhcr.org/uk/protection.html - Unhcr Public Health
https://www.unhcr.org/uk/public-health.html - Unhcr Safeguarding Individuals
https://www.unhcr.org/uk/safeguarding-individuals.html - Unhcr Shelter
https://www.unhcr.org/uk/shelter.html - Unhcr Solutions
https://www.unhcr.org/uk/solutions.html - Unhcr News and Stories
https://www.unhcr.org/uk/news-and-stories.html - Unhcr Ties that Bind: Community Sponsorship in the UK
https://www.unhcr.org/uk/community-sponsorship.html - Unhcr Goal Click Refugees
https://www.unhcr.org/goalclick/ - Unhcr Refugee Week 2021
https://www.unhcr.org/uk/refugeeweek/ - Unhcr Media Centre
https://www.unhcr.org/uk/media-centre.html - Unhcr News Releases
https://www.unhcr.org/uk/news-releases.html - Unhcr Newsletter: The Refugee Brief
https://www.unhcr.org/refugeebrief/ - Unhcr Stories
https://www.unhcr.org/uk/stories.html - Unhcr Special Features
https://www.unhcr.org/uk/special-features.html - Unhcr Announcements
https://www.unhcr.org/search?comid=6156fdeb5&scid=6156fd415 - Unhcr A Great British Welcome
https://www.unhcr.org/uk/a-great-british-welcome.html - Unhcr Our Partners
https://www.unhcr.org/uk/governments-and-partners.html - Unhcr Private Sector Partners - UK
https://www.unhcr.org/uk/main-partners-uk.html - Unhcr United Kingdom for UNHCR
https://www.unhcr.org/uk/united-kingdom-for-unhcr.html - Unhcr Government partners
https://www.unhcr.org/uk/donors.html - Unhcr Non-Governmental Organizations
https://www.unhcr.org/uk/non-governmental-organizations.html - Unhcr Private sector
https://www.unhcr.org/uk/private-sector-supporters.html - Unhcr Sport partners
https://www.unhcr.org/uk/sport-partnerships.html - Unhcr UN and International Institutions
https://www.unhcr.org/uk/united-nation-and-international-institutions.html - Unhcr Additional partnerships
https://www.unhcr.org/uk/partnerships.html - Unhcr Get Involved
https://www.unhcr.org/uk/get-involved.html - Unhcr World Refugee Day
https://www.unhcr.org/uk/world-refugee-day.html - Unhcr Aiming Higher
https://www.unhcr.org/uk/aiming-higher-fund-scholarships-for-refugees.html - Unhcr Youth with Refugees Art Contest
https://www.unhcr.org/uk/youth-with-refugees-art-contest.html - Unhcr Community Sponsorship
https://www.unhcr.org/uk/community-sponsorship-5f9825b34.html - Unhcr Sign up and stay informed
https://www.unhcr.org/uk/stay-informed.html - Unhcr Model UN Refugee Challenge
https://www.unhcr.org/uk/model-un-refugee-challenge.html - Unhcr Supporting refugees in the UK
https://www.unhcr.org/uk/supporting-refugees-in-the-uk.html - Unhcr Become a Supporter
https://www.unhcr.org/uk/become-a-supporter.html - Unhcr Scholarships in Italy allow refugees to dream again
https://www.unhcr.org/uk/news/stories/2022/1/61efd99a4/scholarships-italy-allow-refugees-dream.html - Unhcr view story
https://www.unhcr.org/uk/news/stories/2022/1/61efd99a4/scholarships-italy-allow-refugees-dream.html - Unhcr Schoolteachers in Honduras face threats inside the classroom and out
https://www.unhcr.org/uk/news/stories/2022/1/61eaef864/schoolteachers-honduras-face-threats-inside-classroom.html - Unhcr view story
https://www.unhcr.org/uk/news/stories/2022/1/61eaef864/schoolteachers-honduras-face-threats-inside-classroom.html - Unhcr UNHCR seeks US$59.6 million for 100,000 displaced by violence in Cameroon's Far North region
https://www.unhcr.org/uk/news/briefing/2022/1/61ea74c34/unhcr-seeks-us596-million-100000-displaced-violence-cameroons-far-north.html - Unhcr view briefing note
https://www.unhcr.org/uk/news/briefing/2022/1/61ea74c34/unhcr-seeks-us596-million-100000-displaced-violence-cameroons-far-north.html - Unhcr donate
https://donate.unhcr.org/int/en/cameroon-chad-emergency/ - Unhcr Services for Refugees
https://www.unhcr.org/services-for-refugees/?utm_source=unhcr.org&utm_medium=referral&utm_campaign=HQ_HE_EN_orgpocs - Unhcr Jordan issues record number of work permits to Syrian refugees News and StoriesNews Releases25 Jan 2022
https://www.unhcr.org/uk/news/press/2022/1/61effaa54/jordan-issues-record-number-work-permits-syrian-refugees.html - Unhcr Deteriorating conditions putting Eritrean refugees at grave risk in Tigray News and StoriesNews Releases21 Jan 2022
https://www.unhcr.org/uk/news/briefing/2022/1/61ea6fe74/deteriorating-conditions-eritrean-refugees-grave-risk-tigray.html - Unhcr DONATE NOW
https://donate.unhcr.org/int/en/winter-2021 - https://donate.unhcr.org/int/en/winter-2021
https://donate.unhcr.org/int/en/winter-2021 - Unhcr Information for refugees, asylum-seekers and stateless persons Visit our Help site to find information about asylum procedures, your rights and duties and many more topics.
https://help.unhcr.org/ - Unhcr UNHCR's Mid-Year Trends report
Reflecting on the first six months of this year, the report provides key statistics on refugees and other displaced persons.
https://www.unhcr.org/mid-year-trends - Unhcr Afghanistan on the Brink
Displaced Afghans facing a "humanitarian catastrophe" this winter.
https://www.unhcr.org/spotlight/2021/12/afghanistan-on-the-brink/ - Unhcr A time-saving way to stay on top of displacement news The Refugee Brief delivers weekly roundups of refugee-related media reports and key UNHCR updates straight to your inbox. Browse recent issues and sign up.
https://www.unhcr.org/refugeebrief/latest-issues/ - Unhcr © UNHCR 2001-2022
https://www.unhcr.org/uk/copyright.html - Unhcr Contact us
https://www.unhcr.org/uk/contact-us.html - Unhcr Privacy policy
https://www.unhcr.org/uk/privacy-policy.html - Unhcr Report fraud or abuse
https://www.unhcr.org/uk/making-complaint.html - Unhcr Terms & conditions of use
https://www.unhcr.org/uk/terms-and-conditions.html - Unhcr Frequently Asked Questions
https://www.unhcr.org/uk/frequently-asked-questions.html - Unhcr Sign up for email updates
http://unhcr.org/stay-informed.html
Links - Internal (nofollow)
0:Links - Outbound
11:- Unhcr Español
https://www.acnur.org - Unhcr Refworld
http://www.refworld.org - https://www.facebook.com/sharer.php?u=https://www.unhcr.org/uk
https://www.facebook.com/sharer.php?u=https://www.unhcr.org/uk - https://twitter.com/intent/tweet?source=https://www.unhcr.org&text=The UN Refugee Agency: https://www.unhcr.org&via=refugees
https://twitter.com/intent/tweet?source=https://www.unhcr.org&text=The UN Refugee Agency: https://www.unhcr.org&via=refugees - Unhcr Holiday gifts, handcrafted by refugees
Spread the love and deck your home with gorgeous ornaments from this year's MADE51 holiday collection. Each piece is beautifully handcrafted by refugees and celebrates the talent of its maker.
https://shop.made51.org/collections/holiday-decor - https://twitter.com/refugees
https://twitter.com/refugees - https://www.facebook.com/UNHCR
https://www.facebook.com/UNHCR - https://www.youtube.com/c/unhcr
https://www.youtube.com/c/unhcr - https://www.instagram.com/refugees/
https://www.instagram.com/refugees/ - https://www.tiktok.com/@refugees?lang=en
https://www.tiktok.com/@refugees?lang=en - https://www.linkedin.com/company/166589/admin/
https://www.linkedin.com/company/166589/admin/
Links - Outbound (nofollow)
0:Keyword Cloud for Unhcr.org
sign upsituationdeutschdonateinformationyourstayukcentresiteusrefugeejordanpartnersmedianederlandsfamiliesstoriesreportcentralgetasylumrefugeesdisplacedweyouourcouldglobalfamilyemergencyviewneedasianbspespaolunhcrsearchdoafghanistanmedia centrefranaisnewshelpwinterenglishsignupselectrepublicunited
Longtail Keyword Density for Unhcr.org
Who hosts Unhcr.org?
Unhcr.org Hosting Provider Information
| Hosted IP Address: | Not Applicable |
| Hosted Hostname: | Not Applicable |
| Service Provider: | Unknown |
| Hosted Country: | Not Applicable |
| Location Latitude: | Not Applicable |
| Location Longitude: | Not Applicable |
| Webserver Software: | CloudFlare |
Is "Unknown" in the Top 10 Hosting Companies?
Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%
HTTP Header Analysis for Unhcr.org
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Date: | Sat, 29 Jan 2022 05:46:24 GMT |
| Content-Type: | text/html; charset=UTF-8 |
| Connection: | close |
| CF-Cache-Status: | DYNAMIC |
| Expect-CT: | max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct" |
| Server: | cloudflare |
| CF-RAY: | 6d5028ecbd6b406c-LHR |
| Content-Encoding: | gzip |
Unhcr.org Domain Nameserver Information
| Host | IP Address | Country |
|---|---|---|
| ns-1127.awsdns-12.org | 205.251.196.103 | |
| ns-1747.awsdns-26.co.uk | 205.251.198.211 | |
| ns-399.awsdns-49.com | 205.251.193.143 | |
| ns-808.awsdns-37.net | 205.251.195.40 |
Need to find out who hosts Unhcr.org?
Domain Registration (WhoIs) information for Unhcr.org
Domain Name: UNHCR.ORG
Registry Domain ID: D402546-LROR
Registrar WHOIS Server: whois.directnic.com
Registrar URL: http://www.directnic.com
Updated Date: 2017-05-28T09:15:20Z
Creation Date: 1997-05-04T04:00:00Z
Registry Expiry Date: 2024-05-05T04:00:00Z
Registrar Registration Expiration Date:
Registrar: DNC Holdings, Inc.
Registrar IANA ID: 291
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8778569598
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: UNHCR
Registrant State/Province: GE
Registrant Country: CH
Name Server: NS-1127.AWSDNS-12.ORG
Name Server: NS-1747.AWSDNS-26.CO.UK
Name Server: NS-399.AWSDNS-49.COM
Name Server: NS-808.AWSDNS-37.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-22T04:29:37Z
Websites with Similar Names
Unhcr-arabic.org
المفوضية - المفوضية السامية للأمم المتحدة لشؤون اللاجئين
المفوضية - المفوضية السامية للأمم المتحدة لشؤون اللاجئين
Unhcr-centraleurope.org
UNHCR Central Europe
UNHCR Central Europe
Unhcr-droitsenfants.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Félicitations ! Votre domaine a bien été créé chez OVH !
Unhcr-phapps.org
Page Not Found
Page Not Found
Unhcr-unispourelles.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Félicitations ! Votre domaine a bien été créé chez OVH !
Unhcr-unispourelles.org
Félicitations ! Votre domaine a bien été créé chez OVH !
Félicitations ! Votre domaine a bien été créé chez OVH !
Unhcr-wfp-hub.org
Home - WFP-UNHCR Joint Hub
Home - WFP-UNHCR Joint Hub
Unhcr.ba
Default Parallels Plesk Panel Page
Default Parallels Plesk Panel Page
Unhcr.ch
UNHCR Schweiz und Liechtenstein
UNHCR Schweiz und Liechtenstein
Unhcr.cz
UNHCR Česká republika
UNHCR Česká republika
Recently Updated Websites
Effectiveperformancenetwork.com (1 hour 12 minutes ago.), Latest-554270.funuzai.ru (1 hour 12 minutes ago.), Confident-liskov-0781fc.netlify.app (1 hour 30 minutes ago.), Di7stero.com (1 hour 30 minutes ago.), Hdpornogratis.xxx (1 hour 31 minutes ago.), Satta-king-fast.com (2 hours 9 minutes ago.), Hellabyte.cloud (2 hours 15 minutes ago.), Abyss.to (2 hours 15 minutes ago.), Webdownload.net (2 hours 16 minutes ago.), Sattaking-no.com (2 hours 27 minutes ago.), Sattaking-up.com (2 hours 29 minutes ago.), Fre-skate-lesson.site (2 hours 43 minutes ago.), Make.com (2 hours 53 minutes ago.), Factoriacultural.es (3 hours 4 minutes ago.), Numanzia.com (3 hours 9 minutes ago.), Nftcode-it.com (3 hours 15 minutes ago.), Gurugamer.com (3 hours 21 minutes ago.), Satta-kingn.in (3 hours 27 minutes ago.), Z1fm.online (3 hours 43 minutes ago.), Fesehatk.com (4 hours 2 minutes ago.), Ntinews.com (4 hours 11 minutes ago.), Blumble.com (5 hours 19 minutes ago.), Klamboe.com (6 hours 36 minutes ago.), Boot-upstrongintenselytheproduct.vip (6 hours 43 minutes ago.), Cacheeye.com (7 hours 22 minutes ago.), Sattaking-result.com (8 hours 18 minutes ago.), Sattanom.in (8 hours 20 minutes ago.), Ghostbookwriting.services (8 hours 20 minutes ago.), Satta-king.online (8 hours 22 minutes ago.), Sattaking-number.com (8 hours 23 minutes ago.),
Recently Searched Keywords
shall it meaning in urdu (1 second ago.), lstbc (2 seconds ago.), raffinate (3 seconds ago.), -ms-linear-gradienttop rgba0 (3 seconds ago.), piotr jacek odchodzi z sokoĺa ostrăłda (4 seconds ago.), etsy united kingdom (4 seconds ago.), call this function (4 seconds ago.), warriors seth curry (5 seconds ago.), manteau noir long (5 seconds ago.), your journey starts here (5 seconds ago.), lightly battered (5 seconds ago.), instrumentos complejos y (6 seconds ago.), cuisines tendances actuelles (6 seconds ago.), gratuite partir (7 seconds ago.), raffinata e (8 seconds ago.), shared (9 seconds ago.), raffinata (10 seconds ago.), veter peremen scorpions (11 seconds ago.), 11 oct 2016 (11 seconds ago.), block-title-wrapblock-title-border-2 title (11 seconds ago.), irritable bowel syndrome diet (12 seconds ago.), radosĺaw cielemäcki zawodnikiem wisĺy pĺock (13 seconds ago.), fortuner 2800 cc (14 seconds ago.), travis edward (15 seconds ago.), citrus heights garbage (15 seconds ago.), radosĺaw bella asystentem trenera miedzi (16 seconds ago.), memory training (18 seconds ago.), sh-1111 (18 seconds ago.), tzfangnuo.com (19 seconds ago.), personaccedi (19 seconds ago.),
