Univers-pump.fr  |  Pump | studio 3D | Motion design | Lyon | Paris
Low trust score  | 
Pump est un studio 3D spécialisé dans l'infographie 3D et le motion design : image de synthèse, animation 3D,animation 2D, VFX, module Unity

Univers-pump.fr Website Information

Univers-pump.fr has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 11,460,898, a Majestic Rank of 0, a Domain Authority of 20% and is not listed in DMOZ.

Univers-pump.fr is hosted by ELB MULTIMEDIA in France.
Univers-pump.fr has an IP Address of 92.39.241.144 and a hostname of vps1629-cloud.dns26.com.

The domain univers-pump.fr was registered 6 years 3 months 2 weeks ago by , it was last modified 4 years 3 months 3 weeks ago and currently is set to expire 201 decades 8 years 11 months ago.


Whois information for univers-pump.fr

Full Whois Lookup for Univers-pump.fr Whois Lookup

%%
%% This is the AFNIC Whois server.
%%
%% complete date format : DD/MM/YYYY
%% short date format : DD/MM
%% version : FRNIC-2.5
%%
%% Rights restricted by copyright.
%% See https://www.afnic.fr/en/products-and-services/services/whois/whois-special-notice/
%%
%% Use '-h' option to obtain more information about this service.
%%
%% [2a01:7e00:0000:0000:f03c:91ff:fe84:f734 REQUEST] >> univers-pump.fr
%%
%% RL Net [##########] - RL IP [#########.]
%%

domain: univers-pump.fr
status: ACTIVE
hold: NO
holder-c: AS16191-FRNIC
admin-c: AD14152-FRNIC
tech-c: GS7196-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL59647-FRNIC
registrar: AMEN / Agence des Mdias Numriques
Expiry Date: 24/05/2018
created: 24/05/2013
last-update: 24/05/2017
source: FRNIC

ns-list: NSL59647-FRNIC
nserver: dns1.plaindns.net
nserver: dns2.plaindns.net
source: FRNIC

registrar: AMEN / Agence des Mdias Numriques
type: Isp Option 1
address: 12-14, Rond-Point des Champs Elyses
address: PARIS
country: FR
phone: 0 811 88 77 66
fax-no: +33 1 70 70 21 10
e-mail: Login to show email
http://www.amen.fr
anonymous: NO
registered: 17/01/1999
source: FRNIC

nic-hdl: AS16191-FRNIC
type: ORGANIZATION
contact: Arfmat Studio
address: Arfmat Studio
address: 41, rue Saint Georges
address: 69005 Lyon
address: Rhone
country: FR
phone: +33 4 72 71 01 86
e-mail: Login to show email
AMEN / Agence des Mdias Numriques
changed: 24/05/2013 Login to show email
NO
obsoleted: NO
source: FRNIC

nic-hdl: AD14152-FRNIC
type: PERSON
contact: Aurlien Denancy
address: Arfmat Studio
address: 41, rue Saint Georges
address: 69005 Lyon
address: Rhone
country: FR
phone: +33 4 72 71 01 86
e-mail: Login to show email
AMEN / Agence des Mdias Numriques
changed: 24/05/2013 Login to show email
NO
obsoleted: NO
source: FRNIC

nic-hdl: GS7196-FRNIC
type: PERSON
contact: Guillaume Soubrier
address: CELYPSE
address: 31, rue de Brest
address: 69002 Lyon
address: Rhone
country: FR
phone: +33 6 16 19 45 96
e-mail: Login to show email
AMEN / Agence des Mdias Numriques
changed: 24/05/2013 Login to show email
NO
obsoleted: NO
source: FRNIC

Who hosts Univers-pump.fr?

Univers-pump.fr Web Server Information

Hosted IP Address:92.39.241.144
Hosted Hostname:vps1629-cloud.dns26.com
Service Provider:ELB MULTIMEDIA
Hosted Country:FranceFR
Location Latitude:48.86
Location Longitude:2.35
Webserver Software:Not Applicable

HTTP Header Analysis for Univers-pump.fr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 30 Oct 2015 13:42:23 GMT
Server: Apache
P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"
Content-Encoding: gzip
X-Content-Encoded-By: Joomla! 2.5
Cache-Control: no-cache
Pragma: no-cache
X-Powered-By: PleskLin
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8


Need to find out who hosts Univers-pump.fr?

Univers-pump.fr Free SEO Report

Website Inpage Analysis for Univers-pump.fr

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Univers-pump.fr

widthwinw image httpuniverspumpfrimagesvideobenfinvideo720x404jpgcontrolbarjwplayervideowrapsetup flashplayer httpuniverspumpfrtemplatesvgfashionimagesmediaplayerswffileflashplayer httpuniverspumpfrtemplatesvgfashionimagesmediaplayerswfjwplayervideowrapsetup flashplayerimagesvideobenfondsitemp4autostart truecontrolbar nonewinwwinw imageheightfile imagesvideobenfondsitemp4imageflashplayerwidth winwhttpuniverspumpfrimagesvideobenfinvideo720x404jpgfile imagesvideobenfondsitemp4 heightwidth winw imageimage httpuniverspumpfrimagesvideobenfinvideo720x404jpgimagesvideobenfondsitemp4 heightjwplayervideowrapsetupautostarthttpuniverspumpfrtemplatesvgfashionimagesmediaplayerswftruenone

Longtail Keyword Density for Univers-pump.fr

KeywordsOccurences
winw image httpunivers-pumpfrimagesvideobenfinvideo720x404jpg3
width winw image3
file imagesvideobenfondsitemp4 height3
jwplayervideo-wrapsetup flashplayer httpunivers-pumpfrtemplatesvgfashionimagesmediaplayerswf3
image httpunivers-pumpfrimagesvideobenfinvideo720x404jpg3
controlbar none3
autostart true3
winw image3
width winw3
flashplayer httpunivers-pumpfrtemplatesvgfashionimagesmediaplayerswf3
file imagesvideobenfondsitemp43
imagesvideobenfondsitemp4 height3
jwplayervideo-wrapsetup flashplayer3
none4
image3
httpunivers-pumpfrimagesvideobenfinvideo720x404jpg3
controlbar3
true3
autostart3
winw3
height3
flashplayer3
jwplayervideo-wrapsetup3
httpunivers-pumpfrtemplatesvgfashionimagesmediaplayerswf3
file3
imagesvideobenfondsitemp43
width3

What are the nameservers for univers-pump.fr?

Univers-pump.fr Domain Nameserver Information

HostIP AddressCountry
dns1.plaindns.net 81.88.63.50Italy Italy
dns2.plaindns.net 81.88.63.52Italy Italy

Univers-pump.fr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Univers-pump.fr is a scam?