UPLOAD.EE

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 28,079
Estimated Worth: $541,440

Ühe faili maksimaalne suurus 100MB. Failide kogumaht, allalaadimine ja üleslaadimine on ilma igasuguste piiranguteta. Mugav piltide laadimine.



Domain summary

Last updated
2021-11-30
Domain label
upload
Domain extension
ee
Global Traffic Rank
28,079
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$541,440
Estimated daily income
$752
Estimated monthly income
$22,873

Frequently Asked Questions (FAQ)

Q: When was Upload.ee registered?
A: Upload.ee was registered 1 week, 1 day, 3 hours, 51 minutes, 31 seconds ago on Tuesday, November 30, 2021.
Q: When was the WHOIS for Upload.ee last updated?
A: The WHOIS entry was last updated 1 week, 1 day, 3 hours, 51 minutes, 31 seconds ago on Tuesday, November 30, 2021.
Q: What are Upload.ee's nameservers?
A: DNS for Upload.ee is provided by the following nameservers:
  • ns2.zone.ee
  • ns.zone.eu
  • ns3.zonedata.net
Q: Who is the registrar for the Upload.ee domain?
A: The domain has been registered at .
Q: What is the traffic rank for Upload.ee?
A: Upload.ee ranks 28,079 globally on Alexa. Upload.ee has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Upload.ee each day?
A: Upload.ee receives approximately 62,680 visitors and 376,080 page impressions per day.
Q: What IP address does Upload.ee resolve to?
A: Upload.ee resolves to the IPv4 address 51.91.30.159.
Q: In what country are Upload.ee servers located in?
A: Upload.ee has servers located in the France.
Q: What webserver software does Upload.ee use?
A: Upload.ee is powered by Nginx webserver.
Q: Who hosts Upload.ee?
A: Upload.ee is hosted by OVH SAS in France.
Q: How much is Upload.ee worth?
A: Upload.ee has an estimated worth of $541,440. An average daily income of approximately $752, which is roughly $22,873 per month.

Upload.ee Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Upload.ee Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Upload.ee

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

10 :

Google Adsense

:
pub-5364884771898146

Google Analytics

:
UA-6703115-1

Links - Internal

26:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Upload.ee

mostifuploadee0myvarnewtimeviewedsmartadspacefileslastelseuploadedfunctionfdownload

Longtail Keyword Density for Upload.ee

KeywordsOccurences
files9
most7
06
last5
smartadspace5
viewed4
f4
if4
my3
var3
uploaded3
new3
function3
time3
uploadee3
download3
else3

Who hosts Upload.ee?

Upload.ee Hosting Provider Information

Hosted IP Address:51.91.30.159
Hosted Hostname:upload.ee
Service Provider:OVH SAS
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:nginx

Is "OVH SAS" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
OVH SAS
1.0882%

HTTP Header Analysis for Upload.ee

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 30 Nov 2021 05:36:55 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 12687
Connection: keep-alive
Keep-Alive: timeout=20
Expires: Mon, 26 Jul 1997 05:00:00 GMT
Last-Modified: Tue, 30 Nov 2021 07:36:55 0200
Cache-Control: post-check=0, pre-check=0
Pragma: no-cache
Strict-Transport-Security: max-age=31536000
X-XSS-Protection: 1
P3P: CP="CAO PSA OUR"
Content-Encoding: gzip

Upload.ee Domain Nameserver Information

HostIP AddressCountry
ns2.zone.ee 194.204.49.1
ns.zone.eu 217.146.66.65
ns3.zonedata.net 90.191.225.242


Need to find out who hosts Upload.ee?


Domain Registration (WhoIs) information for Upload.ee

 Search results may not be used for commercial, advertising, recompilation,
repackaging, redistribution, reuse, obscuring or other similar activities.

Estonia .ee Top Level Domain WHOIS server

Domain:
name: upload.ee
status: ok (paid and in zone)
registered: 2010-07-04 03:41:53 +03:00
changed: 2021-10-20 18:15:04 +03:00
expire: 2022-12-19
outzone:
delete:

Registrant:
name: Upload OÜ
org id: 14148404
country: EE
email: Not Disclosed - Visit www.internet.ee for webbased WHOIS
changed: 2021-10-20 18:15:04 +03:00

Administrative contact:
name: Not Disclosed - Visit www.internet.ee for webbased WHOIS
email: Not Disclosed - Visit www.internet.ee for webbased WHOIS
changed: Not Disclosed - Visit www.internet.ee for webbased WHOIS

Technical contact:
name: Not Disclosed - Visit www.internet.ee for webbased WHOIS
email: Not Disclosed - Visit www.internet.ee for webbased WHOIS
changed: Not Disclosed - Visit www.internet.ee for webbased WHOIS

Registrar:
name: Zone Media OÜ
url: http://www.zone.ee
phone: +372 6886886
changed: 2020-07-01 13:55:58 +03:00

Name servers:
nserver: ns2.zone.ee
nserver: ns3.zonedata.net
nserver: ns.zone.eu
changed: 2021-03-10 18:30:07 +02:00

Estonia .ee Top Level Domain WHOIS server
More information at http://internet.ee

Websites with Similar Names

Uploaar.com
Uploaar - Share files - safe, simple and easy!
Upload-ad.com
upload-ad.com – ??????????.com??????????
Upload-cdn.club
upload-cdn.club -&nbspThis website is for sale! -&nbspupload cdn Resources and Information.
Upload-center.com
upload-center.com | 523: Origin is unreachable
Upload-drive.com
Upload Files - Upload-Drive

Recently Updated Websites

Mm-merchandising.com (1 second ago.)Mindmapperbd.net (2 seconds ago.)Etiam.uk.com (2 seconds ago.)Mkto-nld1020081.com (3 seconds ago.)Idealbania.com (3 seconds ago.)Tecwars.com (5 seconds ago.)Cinnamonshorevacationrental.com (8 seconds ago.)Antena-tv-para-caravana.com (8 seconds ago.)Raveaid.org (9 seconds ago.)Kerkstra.com (10 seconds ago.)Gayantiques.com (11 seconds ago.)Alexandersprimemeats.com (12 seconds ago.)Gainlytic.com (16 seconds ago.)Webuyanylockup.com (17 seconds ago.)Nihartpoolandspa.com (18 seconds ago.)Flowerboyusa.com (20 seconds ago.)Cedarhillgroupllc.com (20 seconds ago.)Divhersity.org (22 seconds ago.)Nastradini.net (22 seconds ago.)Nextdoorelectricmn.com (23 seconds ago.)Intuitive.guide (24 seconds ago.)Intliving.com (24 seconds ago.)Zooseite.com (24 seconds ago.)Heathselects.com (25 seconds ago.)Revelationofthecross.org (26 seconds ago.)Gastroenterologie-koeln-nord.de (27 seconds ago.)Kocaelicoriantezgah.com (28 seconds ago.)Gqair.com (28 seconds ago.)Savvycanineequinetraining.com (29 seconds ago.)Schwuugle.de (29 seconds ago.)

Recently Searched Keywords

tweezers meaning (1 second ago.)jesolo e dintorni (1 second ago.)zona franca upm (1 second ago.)hunter bowls laser measure (1 second ago.)lewis model pdf (1 second ago.)fotografiranje porok profesionalno studijsko fotografiranje fotografiranje porok (1 second ago.)funny family portraits ideas (1 second ago.)horse names (1 second ago.)27.275 views (2 seconds ago.)functional groups (2 seconds ago.)13e1f3912a941bc5097c82a326cded3a352e2ba3 (2 seconds ago.)more categories rsaquo (3 seconds ago.)camon 15 pro (3 seconds ago.)摹客 设计规范管理工具 (3 seconds ago.)hunter bowls clothing (3 seconds ago.) lisanslarımız (3 seconds ago.)矩阵首页 (3 seconds ago.)budaya selain dari (3 seconds ago.)2ebohborder-bottom1px solid hsla001004padding15px (4 seconds ago.)1 titlefontsize 3 (5 seconds ago.)highlight (5 seconds ago.)family portraits outfit ideas (5 seconds ago.)brand advice (5 seconds ago.)hostpoint (5 seconds ago.)irish iron disease (6 seconds ago.)nbsp the nbsp (6 seconds ago.)[第二集]氣到抓狂遭寢取影像 ntr.04 鈴村愛里 (7 seconds ago.)bagikan kepada semua orang chord (7 seconds ago.)lewis theory pdf (8 seconds ago.)beasiswa kuliah (8 seconds ago.)