UPPERCASE

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 986,145
Estimated Worth: $9
Category: This site has not been categorized yet

UPPERCASE publishes a quarterly magazine as well as books for the creative and curious. We're inspired by design, craft, illustration and vintage.



Domain summary

Last updated
2021-05-11
Domain label
uppercasegallery
Domain extension
ca
Global Traffic Rank
986,145
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Uppercasegallery.ca registered?
A: Uppercasegallery.ca was registered 6 months, 3 weeks, 2 days, 20 hours, 11 minutes, 56 seconds ago on Tuesday, May 11, 2021.
Q: When was the WHOIS for Uppercasegallery.ca last updated?
A: The WHOIS entry was last updated 6 months, 3 weeks, 2 days, 20 hours, 11 minutes, 56 seconds ago on Tuesday, May 11, 2021.
Q: What are Uppercasegallery.ca's nameservers?
A: DNS for Uppercasegallery.ca is provided by the following nameservers:
  • ns13.domaincontrol.com
  • ns14.domaincontrol.com
Q: Who is the registrar for the Uppercasegallery.ca domain?
A: The domain has been registered at CIRA.
Q: What is the traffic rank for Uppercasegallery.ca?
A: Uppercasegallery.ca ranks 986,145 globally on Alexa. Uppercasegallery.ca has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Uppercasegallery.ca each day?
A: Uppercasegallery.ca receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Uppercasegallery.ca resolve to?
A: Uppercasegallery.ca resolves to the IPv4 address 184.168.131.241.
Q: In what country are Uppercasegallery.ca servers located in?
A: Uppercasegallery.ca has servers located in the United States.
Q: What webserver software does Uppercasegallery.ca use?
A: Uppercasegallery.ca is powered by CloudFlare webserver.
Q: Who hosts Uppercasegallery.ca?
A: Uppercasegallery.ca is hosted by AS-26496-GO-DADDY-COM-LLC in United States.
Q: How much is Uppercasegallery.ca worth?
A: Uppercasegallery.ca has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Uppercasegallery.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Uppercasegallery.ca Free SEO Report

Website Inpage Analysis for Uppercasegallery.ca

H1 Headings

3 :
  1. UPPERCASE
  2. Welcome!
  3. Current Issue / Subscriptions

H2 Headings

0 :

H3 Headings

5 :
  1. Need Help?
  2. Help crowdfund the reprint of Stitch•illo.
  3. Stitch•illo (preorder reprint)
  4. Yarn-Thread-String is shipping now!
  5. Yarn-Thread-String

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

13 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-2761901-1

Links - Internal

28:

Links - Internal (nofollow)

0:

Keyword Cloud for Uppercasegallery.ca

mailedbook gets upthese fibres1 90pxfibrescircle submissionsparticipate stockistsyear subscription 4956optionsmailedplays a part0 230px4956publictitlemailed internationallynew and excitingexpress our individualityfree postercreated by usinglisting for volumesubscription 4956publictitlemailedlittleour valuable resourcesu003cpu003enu003cpu003eu003ciu003eyarnthreadstringu003ciu003eu003cspanu003eu003cspanu003ehighlightsreprintweavingfibre farmersrenewal option belowyear subscription 4952publictitlemailedbelowoption below youyoull gainback issues littleusadetailsu003cayear subscription 4956publictitlemailedwindowboldcommonshopifysavevarianttitlerecycle our valuable2021u003cpu003enu003cpu003eupdatesselect atwoyearmore crafts3natural fibresartistsdategettimeresourcesu003cpu003enu003cpu003eu003ciu003eyarnthreadstringu003ciu003eu003cspanu003eu003cspanu003ehighlights artists craftspeople2021 mailedyarn companies0 breaknaturalyou selectusa one year4956option1mailed internationallyoption belowfunctionyoureplease2021u003cbru003eu003cmeta charsetutf8u003eu003cspanback2021 mailed internationallyminwidth 590pxindividual artisanswe can usetargetblanku003enewsletteru003cau003eu003cpu003enu003cpu003edownloadrenewals gift subscriptionsmedia onlyaprilmayjune 2021u003cbru003e50 julyaugseptcompanies to individualgets up closevaluablebooks fabricgift subscriptions currentmedia only screenwidthembroideryhrefhttpuppercasemagazinecomfree targetblanku003enewsletteru003cau003eu003cpu003enu003cpu003edownloadstringu003cspanu003eu003cpu003enu003cpu003ethis book gets1aprilcrafts are madeknitting crochetvolumeoutfibre tellingpricewindowboldcommonshopifyproductsu encyclopedia booksmarch 2021u003cpu003enu003cpu003eupdatesunique and inspiring4956publictitlemailed internationally twosubscription 4952option1maileduinspirationwe canrmoney 04956optionsmailed to canadacompanies230pxthread and stringu003cspanu003eu003cpu003enu003cpu003ethis2021u003cbru003eu003cmeta charsetutf8u003eu003cspan datamcefragment1u003e51brands well explorevarinspirationu003cau003e4952mailedreturnvarious fibres knittingencyclopediayearsbreakscriptoff selectmailedgets upwell exploreappealposteruse these fibresinternationallylistingvariantpartu003ca hrefhttpuppercasemagazinecomfreeyou save automaticallyotheroffallendblog uppercaseoctnovdecresourcesu003cpu003enu003cpu003eu003ciu003eyarnthreadstringu003ciu003eu003cspanu003eu003cspanu003ehighlightsblog uppercase circlesomeone else pleaseinnovative fibresfibres in unique4956option1mailed internationally twosubscription 4952mailed internationallyrecycle ouronlyusing various fibres2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhenvisualyear subscription 4952option1mailed4952mailed to canada4956option1mailed to canadamadeifonly screenheaderlayoutleftcentersubscription startingfibre brandstwindowboldcommonshopifyvariantsvariantidweinternationally twosubscription 49568000automatically 30 offmacram and manyrugmaking macramcraftspeople and creativeinternationally one yearsubscription 4956publictitlemailed internationallybookscadaddinspiringrresponsibilityautomatically 30poster u003ca hrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl0individuality creativity4952mailed internationally two5idmailed to canadaourjulyaugsept 2021u003cbru003eu003cmetacharsetutf8u003eu003cspan0 0 230pxusing variousweaving sewingdiscountssewing0break caseproductinternationally oneoctnovdec 2021u003cbru003eu003cmeta charsetutf8u003e522021u003cbru003e500 1crochet weavingsubmissionsparticipate stockists2off the priceundefinedcreativitywidth 204956publictitlemailed to canada49568000numbersubscriptionenterexpress ourfibre brands wellfabricjssubscription 4952optionsmailed internationallybelow you saveindividual artisans welljulyaugsept 2021u003cbru003eu003cmeta charsetutf8u003eu003cspanfibre farmers threadu003ca hrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl0recyclestockistsnew dategettimeif typeofsubscription 4956mailed internationally4956mailed internationally oneweeklyissue backonestringu003cspanu003eu003cpu003enu003cpu003ethislook at naturaltwo year subscription49 aprilstoriesheaderitemlogofabric blog uppercasepurchase a giftuppercasemanyatwoyear renewal590pxlittle u encyclopediacanadiandesign playstransaction2021u003cbru003eu003cmeta charsetutf8u003e52 janfebmarch4952option1mailedyear subscription 4952mailedexplorerepurposeyarntargetblanku003ehereu003cau003eu003cpu003enu003cpu003eu003cpu003enu003cpu003eu003cspanu003esou003ca hrefhttpwwwencyclopediaofinspirationcomu003euppercase encyclopediaplaystargetblanku003enewsletteru003cau003eu003cpu003enu003cpu003edownload a free4952publictitlemailed to canadastarting with 49yournullup closevaluable resourcesu003cpu003enu003cpu003eu003ciu003eyarnthreadstringu003ciu003eu003cspanu003eu003cspanu003ehighlights artistsboldindexysomeonerenewal startingcircle4952optionsmailedheaderitemlogo headerlayoutleftcenterartisans well looksewing embroiderypersonal with fibrejanfebmarch 2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhen2021u003cpu003enu003cpu003eupdates and previewsnameu encyclopediaautomatically4956optionsmailed internationallycan usesubscriptionsyearpersonal4952publictitlemailed internationallysubscription 4952optionsmailedrenewalthancontactundefined ifsubscription 4956optionsmailed internationallyhandle productways youllrepurpose and recycle2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhen you selectrenewalswinboomrlexplore innovativeelse ifencyclopedia booksrenewals giftplannednorthordermailed internationally twowe makermoney 0 breakmaxwidthsavereleasedgainfibres knittingblogsubscriptions currentelse pleasesubscriptions renewals gift4952option1mailed internationally30 offorderstelling the storiesvisual appealoptionbelow youindividualhrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl0many moreembroidery rugmakingmacramuppercase circle submissionsparticipatestring typeofgift subscriptionsexcitingexplore innovative fibreswindowboldcommonshopifyhandlesminwidthcreative entrepreneursneedfarmerswellcan0 0orderingartisansyear subscription90pxappeal of fibrermoney 2embroidery rugmaking macramsubscription 4952mailedyou select atwoyeardatamcefragment1u003e51brandsfibre isandknittingbook4952optionsmailed to canada2021u003cbru003e50 julyaugseptjulyaugsepttheir4956mailedapril 2021getsstockists need helpencyclopedia books fabricselectmailedthread49 april 2021hrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl0 targetblanku003ehereu003cau003eu003cpu003enu003cpu003eu003cpu003enu003cpu003eu003cspanu003eso muchjustitemssubscriptions renewals0 1 90pxscreenvariantidhrefhttpwwwencyclopediaofinspirationcomu003euppercaseshippingone year subscriptioncurrentapril 2021 mailedcanada or usasubscription 4952publictitlemailedcharsetutf8u003eu003cspan datamcefragment1u003e51theyprice of two6mediayear subscription 4952optionsmailedprocesseswanttwopreordervolume is plannedcadboldcommoncraftsfarmers thread4isandwindowboldcommonshopifyvariantsinspiring ways youllcreativewindowboldinspirationu003cau003e this volumeposter u003capurchasecloseone yearusa oneinspiring waysmailsiteheaderlogoour individuality2 break2 break casedesignusa two yearperspectiveusing4956optionsmailed internationally twocircle submissionsparticipateselectmailed to canadafreesubscription 4956option1mailedatwoyear renewal optionpreorder listingdatamcefragment1u003e51 octnovdecvarious fibresbook getshrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl0 targetblanku003ehereu003cau003eu003cpu003enu003cpu003eu003cpu003enu003cpu003eu003cspanu003esoscreen and minwidthuppercase u003cafibres knitting crochetmailed internationally onemany more craftscharsetutf8u003e52current issuebold2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhen youreleased in march4952option1mailed internationally oneisand how wemarchwindowboldcommonshopifyproductshandlesubscription 4956optionsmailedu003ca hrefhttpuppercasemagazinecomfree targetblanku003enewsletteru003cau003eu003cpu003enu003cpu003edownloadentrepreneurs who uselittle ubillingjanfebmarchaprilmayjune49568000 cadaddyou savesubmissionsparticipatetelling4952publictitlemailed internationally onewaysmailed internationallyissues littleartisans wellup4956mailed internationallyour individuality creativity0 break caseartists craftspeoplermoney 2 breakresourcesu003cpu003enu003cpu003eu003ciu003eyarnthreadstringu003ciu003eu003cspanu003eu003cspanu003ehighlights artistswell explore innovativepagelibs2021u003cbru003eu003cmetacharsetutf8u003eu003cspan datamcefragment1u003e51 octnovdechelpbrands wellsave automatically 30stringvaluable resourcesu003cpu003enu003cpu003eu003ciu003eyarnthreadstringu003ciu003eu003cspanu003eu003cspanu003ehighlightsyarn threadprocesses from fibreselect atwoyear renewalsomeone elseways youll gaintargetblanku003ehereu003cau003eu003cpu003enu003cpu003eu003cpu003enu003cpu003eu003cspanu003eso muchuniqueindividualitythey are madeuseshiptitleoption1defaultcrochet weaving sewingsave automaticallysewing embroidery rugmakingbooks fabric blogvarioussubscription 4956mailedselectissueaprilmayjune 2021u003cbru003e50stockists needuppercase u003ca hrefhttpuppercasemagazinecomfreeback issuesfontsizepossibleoctnovdec 2021u003cbru003eu003cmetatypeofsubscription 4952option1mailed internationallytruehandleyear subscription 4956option1mailedsubscription 4956option1mailed internationally4952optionsmailed internationally oneencyclopedia of inspirationu003cau003eyear subscription 49568000year subscription 4956mailedexpressrugmakingnewmake is createdinternationally two yearcharsetutf8u003e52 janfebmarchcharsetutf8u003e52 janfebmarch 2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhenreceiveusa twomoregain a new4952option1mailed to canadacartcurrent issue backour valuablestartingissues little upreviews2021u003cbru003eu003cmeta charsetutf8u003e52elseu003ca hrefhttpwwwencyclopediaofinspirationcomu003euppercaseanytwo yearlookclose and personalsubscription 4952publictitlemailed internationally4952publictitlemailedif youreyouissue back issuesfibreuse thesegiftfibres that repurpose2021u003cbru003e50 julyaugsept 2021u003cbru003eu003cmetamuchcraftspeopleissuesknitting crochet weavingstringu003cspanu003eu003cpu003enu003cpu003ethis bookhrefhttpwwwencyclopediaofinspirationcomu003euppercase encyclopediaatwoyearuppercase circlecanadau003ca hrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl0 targetblanku003ehereu003cau003eu003cpu003enu003cpu003eu003cpu003enu003cpu003eu003cspanu003esofabric blogmade possibleexciting perspectiverenewal optioncasesubmissionsparticipate stockists needcrochetentrepreneurscopythread and yarn4956publictitlemailedneed help4952mailed internationallyemailetheseweaving sewing embroiderywell looksubscriptions current issuemakeyoullcreated4952optionsmailed internationally4956optionsmailedfree poster u003ca4956option1maileddatamcefragment1u003e51 octnovdec 2021u003cbru003eu003cmetapostedsubscription 49568000 cadaddvolume yeachtwo individualjanfebmarch 2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhen yougift subscriptionpossible with yarninnovativestories and processessenthrefhttpuppercasemagazinecomfreermoney

Longtail Keyword Density for Uppercasegallery.ca

KeywordsOccurences
canada or usa36
one year subscription36
two year subscription36
internationally one year18
usa one year18
usa two year18
internationally two year18
starting with 4915
april 2021 mailed12
49 april 202112
screen and min-width7
aprilmayjune 2021u003cbru003e50 julyaugsept6
year subscription 49-52mailed6
year subscription 49-56optionsmailed6
year subscription 49-56publictitlemailed6
year subscription 49-56option1mailed6
media only screen6
year subscription 49-52optionsmailed6
year subscription 49-52publictitlemailed6
below you save6
option below you6
renewal option below6
mailed to canada6
automatically 30 off6
atwo-year renewal option6
select atwo-year renewal6
you select atwo-year6
2021u003cbru003eu003cmeta charsetutf-8u003e52 janfebmarch6
save automatically 306
year subscription 49-52option1mailed6
price of two6
octnovdec 2021u003cbru003eu003cmeta charsetutf-8u003e526
off the price6
2021 mailed internationally6
you save automatically6
book gets up5
using various fibres5
our individuality creativity5
thread and stringu003cspanu003eu003cpu003enu003cpu003ethis5
gets up close5
possible with yarn5
crafts are made5
many more crafts5
macram and many5
embroidery rug-making macram5
sewing embroidery rug-making5
weaving sewing embroidery5
crochet weaving sewing5
knitting crochet weaving5
fibres knitting crochet5
various fibres knitting5
created by using5
we can use5
2021u003cpu003enu003cpu003eupdates and previews5
listing for volume5
u003ca hrefhttpwwwencyclopediaofinspirationcomu003euppercase encyclopedia5
encyclopedia of inspirationu003cau003e5
inspirationu003cau003e this volume5
volume is planned5
released in march5
uppercase u003ca hrefhttpuppercasemagazinecomfree5
make is created5
u003ca hrefhttpuppercasemagazinecomfree targetblanku003enewsletteru003cau003eu003cpu003enu003cpu003edownload5
targetblanku003enewsletteru003cau003eu003cpu003enu003cpu003edownload a free5
free poster u003ca5
poster u003ca hrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl05
u003ca hrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl0 targetblanku003ehereu003cau003eu003cpu003enu003cpu003eu003cpu003enu003cpu003eu003cspanu003eso5
hrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl0 targetblanku003ehereu003cau003eu003cpu003enu003cpu003eu003cpu003enu003cpu003eu003cspanu003eso much5
express our individuality5
inspiring ways youll5
isand how we5
they are made5
recycle our valuable5
repurpose and recycle5
fibres that repurpose5
new and exciting5
well explore innovative5
brands well explore5
fibre brands well5
appeal of fibre5
plays a part5
look at natural5
valuable resourcesu003cpu003enu003cpu003eu003ciu003eyarn-thread-stringu003ciu003eu003cspanu003eu003cspanu003ehighlights artists5
artisans well look5
individual artisans well5
companies to individual5
thread and yarn5
fibre farmers thread5
processes from fibre5
stories and processes5
telling the stories5
personal with fibre5
close and personal5
our valuable resourcesu003cpu003enu003cpu003eu003ciu003eyarn-thread-stringu003ciu003eu003cspanu003eu003cspanu003ehighlights5
explore innovative fibres5
unique and inspiring5
stringu003cspanu003eu003cpu003enu003cpu003ethis book gets5
craftspeople and creative5
entrepreneurs who use5
use these fibres5
fibres in unique5
gain a new5
ways youll gain5
resourcesu003cpu003enu003cpu003eu003ciu003eyarn-thread-stringu003ciu003eu003cspanu003eu003cspanu003ehighlights artists craftspeople5
2021u003cbru003eu003cmeta charsetutf-8u003eu003cspan data-mce-fragment1u003e514
julyaugsept 2021u003cbru003eu003cmeta charsetutf-8u003eu003cspan4
2021u003cbru003e50 julyaugsept 2021u003cbru003eu003cmeta4
charsetutf-8u003e52 janfebmarch 2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhen4
janfebmarch 2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhen you4
someone else please4
2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhen you select4
rmoney 2 break4
data-mce-fragment1u003e51 octnovdec 2021u003cbru003eu003cmeta4
charsetutf-8u003eu003cspan data-mce-fragment1u003e51 octnovdec4
49-56option1mailed internationally two3
mailed internationally two3
subscription 49-56option1mailed internationally3
subscription 49-56publictitlemailed internationally3
49-56publictitlemailed internationally two3
subscription 49-56optionsmailed internationally3
49-52publictitlemailed to canada3
49-52optionsmailed internationally one3
subscription 49-52optionsmailed internationally3
49-52publictitlemailed internationally one3
subscription 49-52publictitlemailed internationally3
mailed internationally one3
49-52option1mailed to canada3
subscription 49-52option1mailed internationally3
49-56optionsmailed to canada3
49-56publictitlemailed to canada3
49-56option1mailed to canada3
49-52optionsmailed to canada3
49-52option1mailed internationally one3
u encyclopedia books3
subscription 49-568000 cadadd3
fabric blog uppercase3
2 break case3
rmoney 0 break3
0 break case3
subscriptions renewals gift3
renewals gift subscriptions3
gift subscriptions current3
subscriptions current issue3
current issue back3
issue back issues3
back issues little3
issues little u3
little u encyclopedia3
encyclopedia books fabric3
books fabric blog3
blog uppercase circle3
year subscription 49-5680003
uppercase circle submissionsparticipate3
circle submissionsparticipate stockists3
submissionsparticipate stockists need3
stockists need help3
0 1 90px3
0 0 230px3
purchase a gift3
selectmailed to canada3
49-52mailed to canada3
year subscription 49-56mailed3
subscription 49-56mailed internationally3
49-56mailed internationally one3
subscription 49-52mailed internationally3
49-52mailed internationally two3
49-56optionsmailed internationally two3
year subscription72
one year36
two year36
internationally one18
internationally two18
usa one18
usa two18
49 april15
2021 mailed12
april 202112
octnovdec 2021u003cbru003eu003cmeta6
automatically 306
two individual6
subscription 49-52option1mailed6
subscription 49-52publictitlemailed6
you save6
subscription 49-52optionsmailed6
subscription 49-56option1mailed6
subscription 49-56publictitlemailed6
subscription 49-56optionsmailed6
mailed internationally6
2021u003cbru003eu003cmeta charsetutf-8u003e526
save automatically6
30 off6
media only6
select atwo-year6
2021u003cbru003e50 julyaugsept6
only screen6
aprilmayjune 2021u003cbru003e506
charsetutf-8u003e52 janfebmarch6
break case6
if typeof6
you select6
subscription 49-52mailed6
atwo-year renewal6
renewal option6
option below6
below you6
min-width 590px6
ways youll5
valuable resourcesu003cpu003enu003cpu003eu003ciu003eyarn-thread-stringu003ciu003eu003cspanu003eu003cspanu003ehighlights5
resourcesu003cpu003enu003cpu003eu003ciu003eyarn-thread-stringu003ciu003eu003cspanu003eu003cspanu003ehighlights artists5
artists craftspeople5
creative entrepreneurs5
these fibres5
inspiring ways5
our individuality5
youll gain5
exciting perspective5
fibre isand5
we can5
can use5
express our5
individuality creativity5
recycle our5
our valuable5
use these5
innovative fibres5
u003ca hrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl05
embroidery rug-making5
sewing embroidery5
weaving sewing5
crochet weaving5
explore innovative5
fibres knitting5
various fibres5
using various5
we make5
targetblanku003ehereu003cau003eu003cpu003enu003cpu003eu003cpu003enu003cpu003eu003cspanu003eso much5
hrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl0 targetblanku003ehereu003cau003eu003cpu003enu003cpu003eu003cpu003enu003cpu003eu003cspanu003eso5
poster u003ca5
many more5
free poster5
hrefhttpuppercasemagazinecomfree targetblanku003enewsletteru003cau003eu003cpu003enu003cpu003edownload5
u003ca hrefhttpuppercasemagazinecomfree5
uppercase u003ca5
march 2021u003cpu003enu003cpu003eupdates5
hrefhttpwwwencyclopediaofinspirationcomu003euppercase encyclopedia5
u003ca hrefhttpwwwencyclopediaofinspirationcomu003euppercase5
volume y5
pre-order listing5
subscription starting5
renewal starting5
rug-making macram5
knitting crochet5
more crafts5
fibre telling5
well explore5
brands well5
fibre brands5
visual appeal5
design plays5
natural fibres5
made possible5
artisans well5
individual artisans5
yarn companies5
farmers thread5
fibre farmers5
well look5
up close5
book gets5
yarn thread5
stringu003cspanu003eu003cpu003enu003cpu003ethis book5
gets up5
2 break4
data-mce-fragment1u003e51 octnovdec4
charsetutf-8u003eu003cspan data-mce-fragment1u003e514
2021u003cbru003eu003cmeta charsetutf-8u003eu003cspan4
julyaugsept 2021u003cbru003eu003cmeta4
gift subscription4
else please4
someone else4
rmoney 24
2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhen you4
janfebmarch 2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhen4
handle product4
back issues4
new dategettime4
header-item--logo header-layout--left-center4
49-52option1mailed internationally3
49-56optionsmailed internationally3
49-52publictitlemailed internationally3
49-52optionsmailed internationally3
49-56option1mailed internationally3
49-56publictitlemailed internationally3
else if3
issue back3
49-568000 cadadd3
fabric blog3
undefined if3
string typeof3
rmoney 03
0 break3
subscriptions renewals3
renewals gift3
gift subscriptions3
subscriptions current3
current issue3
issues little3
little u3
u encyclopedia3
encyclopedia books3
books fabric3
blog uppercase3
subscription 49-5680003
uppercase circle3
circle submissionsparticipate3
submissionsparticipate stockists3
stockists need3
need help3
0 13
1 90px3
0 03
0 230px3
if youre3
off selectmailed3
subscription 49-56mailed3
49-56mailed internationally3
49-52mailed internationally3
width 203
subscription91
year72
two44
if41
one40
usa37
internationally36
canada36
you26
null20
fibres20
var20
fibre20
your19
u003ca17
renewal17
017
115
april15
starting15
uppercase15
function14
volume14
well14
use14
typeof13
213
our12
product12
off12
mailed12
thread11
we11
individual11
made11
else11
new11
please10
yarn10
issue10
2021u003cbru003eu003cmeta10
select10
encyclopedia10
close9
price9
option8
only8
undefined8
screen8
38
gift8
boldindex8
can8
media8
purchase7
name7
book7
below7
up7
min-width7
rmoney7
case7
break7
released7
true6
issues6
back6
590px6
e6
possible6
their6
more6
subscriptions6
express6
these6
each6
save6
cadadd6
shipping6
creative6
automatically6
atwo-year6
janfebmarch6
charsetutf-8u003e526
octnovdec6
julyaugsept6
46
2021u003cbru003e506
number6
49-52option1mailed6
handle6
49-52mailed6
aprilmayjune6
49-52publictitlemailed6
49-56optionsmailed6
49-52optionsmailed6
return6
49-56publictitlemailed6
49-56option1mailed6
make6
items6
perspective5
230px5
unique5
inspiring5
ways5
gain5
exciting5
sent5
isand5
books5
individuality5
creativity5
than5
contact5
current5
all5
90px5
entrepreneurs5
youll5
craftspeople5
rug-making5
2021u003cpu003enu003cpu003eupdates5
telling5
previews5
posted5
personal5
gets5
stringu003cspanu003eu003cpu003enu003cpu003ethis5
crafts5
hrefhttpuppercasemagazinecomfree5
many5
targetblanku003enewsletteru003cau003eu003cpu003enu003cpu003edownload5
macram5
free5
poster5
march5
embroidery5
max-width5
hrefhttpswwwdropboxcomsvzrs4p143bjmfoivolume20y20preorder20posterpdfdl05
targetblanku003ehereu003cau003eu003cpu003enu003cpu003eu003cpu003enu003cpu003eu003cspanu003eso5
much5
sewing5
t5
weaving5
crochet5
knitting5
created5
artists5
various5
using5
55
planned5
innovative5
brands5
appeal5
visual5
part5
plays5
design5
repurpose5
recycle5
they5
natural5
valuable5
look5
artisans5
companies5
farmers5
processes5
pre-order5
listing5
stories5
y5
resourcesu003cpu003enu003cpu003eu003ciu003eyarn-thread-stringu003ciu003eu003cspanu003eu003cspanu003ehighlights5
hrefhttpwwwencyclopediaofinspirationcomu003euppercase5
inspirationu003cau003e5
explore5
windowboldcommonshopifyproductshandle4
bold4
windowboldcommonshopifyvariants4
email4
variantid4
variant4
someone4
data-mce-fragment1u003e514
charsetutf-8u003eu003cspan4
windowboldcommonshopifyvariantsvariantid4
windowboldcommonshopifyproducts4
billing4
windowboldcommonshopifyhandles4
header-layout--left-center4
title4
titleoption1default4
little4
width4
dategettime4
end4
need4
just4
cart4
orders4
header-item--logo4
other4
site-headerlogo4
inspiration4
2022u003cspanu003eu003cbru003eu003cpu003enu003cpu003eu003cstrongu003ewhen4
years4
order4
want4
id3
pagelibs3
r3
discounts3
63
script3
weekly3
windowboldcommonshopifysavevariant3
cad3
windowbold3
enter3
string3
ship3
boldcommon3
out3
winboomrl3
renewals3
u3
fabric3
blog3
circle3
submissionsparticipate3
stockists3
help3
font-size3
reprint3
preorder3
youre3
49-5680003
north3
any3
responsibility3
details3
ordering3
canadian3
receive3
mail3
transaction3
copy3
selectmailed3
49-56mailed3
js3

Who hosts Uppercasegallery.ca?

Uppercasegallery.ca Hosting Provider Information

Hosted IP Address:184.168.131.241
Hosted Hostname:ip-184-168-131-241.ip.secureserver.net
Service Provider:AS-26496-GO-DADDY-COM-LLC
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "AS-26496-GO-DADDY-COM-LLC" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%

HTTP Header Analysis for Uppercasegallery.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 11 May 2021 12:16:06 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Sorting-Hat-PodId: 88
X-Sorting-Hat-ShopId: 20355
X-Storefront-Renderer-Rendered: 1
Content-Encoding: gzip
ETag: cacheable:594b0a348333735679f2f115f06755ed
X-Alternate-Cache-Key: cacheable:3cd56d06474ed2990667946525243ef9
X-Cache: hit, server
X-Frame-Options: DENY
Content-Security-Policy: block-all-mixed-content; frame-ancestors 'none'; upgrade-insecure-requests;
Strict-Transport-Security: max-age=7889238
X-ShopId: 20355
X-ShardId: 88
Vary: Accept
Content-Language: en
X-Shopify-Stage: production
X-Dc: gcp-us-central1,gcp-us-central1,gcp-us-central1
X-Request-ID: e9f0ffa4-de20-46d8-a4cc-d2c5150b182f
X-XSS-Protection: 1; mode=block
X-Download-Options: noopen
X-Content-Type-Options: nosniff
X-Permitted-Cross-Domain-Policies: none
NEL: {"report_to":"network-errors","max_age":2592000,"success_fraction":0.0001}
Report-To: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifysvc.com/v1/reports/nel/20190325/shopify"}]}
CF-Cache-Status: DYNAMIC
cf-request-id: 09fcf42b420000e698c2321000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 64db56253875e698-LHR
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Uppercasegallery.ca Domain Nameserver Information

HostIP AddressCountry
ns13.domaincontrol.com 97.74.106.7
ns14.domaincontrol.com 173.201.74.7


Need to find out who hosts Uppercasegallery.ca?


Domain Registration (WhoIs) information for Uppercasegallery.ca

 Domain Name: uppercasegallery.ca
Registry Domain ID: D257429-CIRA
Registrar WHOIS Server: whois.ca.fury.ca
Registrar URL: ca.godaddy.com
Updated Date: 2019-12-31T16:09:36Z
Creation Date: 2004-12-30T18:57:35Z
Registry Expiry Date: 2021-12-30T05:00:00Z
Registrar: Go Daddy Domains Canada, Inc
Registrar IANA ID: not applicable
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: REDACTED FOR PRIVACY
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: REDACTED FOR PRIVACY
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Registry Billing ID: REDACTED FOR PRIVACY
Billing Name: REDACTED FOR PRIVACY
Billing Organization: REDACTED FOR PRIVACY
Billing Street: REDACTED FOR PRIVACY
Billing City: REDACTED FOR PRIVACY
Billing State/Province: REDACTED FOR PRIVACY
Billing Postal Code: REDACTED FOR PRIVACY
Billing Country: REDACTED FOR PRIVACY
Billing Phone: REDACTED FOR PRIVACY
Billing Phone Ext: REDACTED FOR PRIVACY
Billing Fax: REDACTED FOR PRIVACY
Billing Fax Ext: REDACTED FOR PRIVACY
Billing Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Name Server: ns13.domaincontrol.com
Name Server: ns14.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-05-11T12:16:08Z

Websites with Similar Names

Recently Updated Websites

Kulreet.com (7 seconds ago.)Choicecenter.com (7 seconds ago.)Cybersecurityfox.com (12 seconds ago.)Cxgc123.com (15 seconds ago.)Element8.agency (16 seconds ago.)Szwenly.com (21 seconds ago.)Platzlzwei.com (23 seconds ago.)Usmanfarooqtech.com (24 seconds ago.)Cross-country-trips.com (24 seconds ago.)Skillscorps.net (28 seconds ago.)Hyggetransit.com (30 seconds ago.)Ultimate.link (30 seconds ago.)Harveybainbridge.com (35 seconds ago.)Hepsibirilan.net (39 seconds ago.)Heavenbeam.com (40 seconds ago.)Lcarescuegolf.com (40 seconds ago.)K-12esports.info (42 seconds ago.)Ratingsco.com (42 seconds ago.)Futureramtrucks.com (44 seconds ago.)Takealonglearning.net (45 seconds ago.)Wwwcoinex.com (51 seconds ago.)Zpfast.com (51 seconds ago.)Adamaiken.com (53 seconds ago.)Netshoot.pl (54 seconds ago.)Kacangofficial.com (57 seconds ago.)Cottagegardenercomox.com (58 seconds ago.)Bartomeorealty2.com (1 minute 3 seconds ago.)Venalmar.com (1 minute 6 seconds ago.)Armoire-electrique.com (1 minute 8 seconds ago.)Haas-schreinerei.com (1 minute 9 seconds ago.)

Recently Searched Keywords

0s--bgd255255255--txtd219219219--alpha-txtd1--brwd1px--alpha-txtlbl1--txtlblrq000--alpha-txtlblrq0--fntprefixnormal normal (1 second ago.)zweifel (1 second ago.)dotsfalse (1 second ago.)bussiness (2 seconds ago.)палатки для кемпинга  (2 seconds ago.)isocitrate dehydrogenase (idh) (2 seconds ago.)sunitha actress (2 seconds ago.)komposisi nutrisalin (4 seconds ago.)gallery-item-bottom-info info-element-custom-button-wrapper (4 seconds ago.)pge synthase (4 seconds ago.)vertical station (5 seconds ago.)tgf-β  (5 seconds ago.)muğla mimar (6 seconds ago.)cut the cost (6 seconds ago.)topk (6 seconds ago.)fatheadrealty times (6 seconds ago.)unhackable internet (7 seconds ago.)adrenergic receptors (7 seconds ago.)mm crystal (8 seconds ago.)supplement into (9 seconds ago.)tostring (10 seconds ago.)chanterelle season (10 seconds ago.)吃货教教你女朋友的正确食用方式 (10 seconds ago.)future open up (11 seconds ago.)during the timeout (11 seconds ago.)cannabinoid receptors (11 seconds ago.)handheld massagers (11 seconds ago.)lipid metabolism (11 seconds ago.)membrane transporters | 跨膜输运 (12 seconds ago.)important tdblockslide (12 seconds ago.)