Urlaubspiraten.de

Website Thumbnail
Checking...
Urlaub & Reiseschnäppchen günstig buchen | Urlaubspiraten

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 166,923
Estimated Worth: $75,000
Last updated:2020-10-15
Category: Travel > Tourism

Jetzt günstig deinen nächsten Urlaub buchen ✓ Top Auswahl ✓ Super Deals ✓ Bestpreisgarantie ✈️ Finde dein perfektes Angebot und spare mit den Urlaubspiraten!


Domain summary

Domain label
urlaubspiraten
Domain extension
de
Global Traffic Rank
166,923
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$75,000
Estimated daily income
$125
Estimated monthly income
$3,802

Rank summary

How is urlaubspiraten.de ranked relative to other sites:

Percentage of visits to urlaubspiraten.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Urlaubspiraten.de registered?
A: Urlaubspiraten.de was registered 1 month, 1 week, 4 days, 15 hours, 24 minutes, 20 seconds ago on Thursday, October 15, 2020.
Q: When was the WHOIS for Urlaubspiraten.de last updated?
A: The WHOIS entry was last updated 2 years, 9 months, 1 week, 5 days, 15 hours, 24 minutes, 20 seconds ago on Wednesday, February 14, 2018.
Q: What are Urlaubspiraten.de's nameservers?
A: DNS for Urlaubspiraten.de is provided by the following nameservers:
  • bill.ns.cloudflare.com
  • elaine.ns.cloudflare.com
Q: Who is the registrar for the Urlaubspiraten.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Urlaubspiraten.de?
A: Urlaubspiraten.de ranks 166,923 globally on Alexa. Urlaubspiraten.de has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Urlaubspiraten.de each day?
A: Urlaubspiraten.de receives approximately 10,017 visitors and 50,085 page impressions per day.
Q: What IP address does Urlaubspiraten.de resolve to?
A: Urlaubspiraten.de resolves to the IPv4 address 104.20.208.118.
Q: In what country are Urlaubspiraten.de servers located in?
A: Urlaubspiraten.de has servers located in the United States.
Q: What webserver software does Urlaubspiraten.de use?
A: Urlaubspiraten.de is powered by CloudFlare webserver.
Q: Who hosts Urlaubspiraten.de?
A: Urlaubspiraten.de is hosted by CloudFlare, Inc. in United States.
Q: How much is Urlaubspiraten.de worth?
A: Urlaubspiraten.de has an estimated worth of $75,000. An average daily income of approximately $125, which is roughly $3,802 per month.

Urlaubspiraten.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Urlaubspiraten.de Free SEO Report

Website Inpage Analysis for Urlaubspiraten.de

H1 Headings

1 :
  1. Wer sind die Urlaubspiraten?

H2 Headings

26 :
  1. 2 Nächte Ultra All Inclusive im 4° Hotel in Kaprun ab 99€ p.P. | 5 Nächte ab 299€ p.P.
  2. Pauschalreisen bis Abreise Oktober 2021 bis zu 2 Wochen vor Abreise kostenfrei stornieren!
  3. Die wichtigsten Infos zum neuen Beherbergungsverbot *UPDATE*
  4. Herbsturlaub in Schwerin
  5. Für Mitarbeiter und Familien!
  6. Entspannung im Taunus
  7. Besucht doch mal unsere Nachbarn
  8. Gutschein für Tropical Islands
  9. Euer eigenes Haus am See
  10. Flüge in die Karibik zur besten Reisezeit
  11. Der Sonne hinterher
  12. Das einzige Hotel im UNESCO-Weltkulturerbe
  13. Bucht jetzt euren Traumurlaub
  14. Herbst am Gardasee
  15. Bestpreise im Herbst!
  16. Corona-News
  17. Outdoorgoals im Allgäu
  18. Wird das euer Südsee-Abenteuer?
  19. Traut ihr euch?
  20. Wintertraum in Berchtesgaden
  21. Aktuell: 28°C Tagestemperatur
  22. Wähle ein Thema für deine nächste Reise!
  23. Unsere Kunden lieben uns
  24. Urlaub günstig buchen: Buchungsanleitung für günstige Reiseschnäppchen
  25. Urlaubsschnäppchen: Die günstigsten Destinationen für billigen Urlaub
  26. Die beliebtesten Urlaubsziele unserer Piraten

H3 Headings

26 :
  1. Strand und Meer
  2. Essen und Trinken
  3. Action und Abenteuer
  4. Städtetrips
  5. Wintersport
  6. Was macht unsere Urlaubsschnäppchen aus? Mit Piratenpreisen billig reisen!
  7. Wohin könnt ihr mit unseren Reise-Schnäppchen in den Urlaub fliegen?
  8. Wie könnt ihr bei uns Urlaubspiraten individuelle Pauschalreisen buchen?
  9. Mit den Piraten keinen Deal verpassen und günstig Urlaub machen!
  10. Urlaub in Tschechien:
  11. Urlaub in Polen:
  12. Urlaub in der Slowakei:
  13. Urlaub in Ungarn:
  14. Urlaub in Kroatien:
  15. Urlaub in Frankreich:
  16. Urlaub in Ägypten:
  17. Urlaub auf Mallorca:
  18. Urlaub auf den Kanaren:
  19. Urlaub in der Türkei:
  20. Urlaub in Portugal:
  21. Urlaub in Italien:
  22. Lerne uns kennen
  23. Rechtliches
  24. Du willst keinen Deal mehr verpassen?
  25. Nie wieder einen Deal verpassen!
  26. Folge uns auf

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

51 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

149:
  1. https://www.urlaubspiraten.de
    https://www.urlaubspiraten.de
  2. Urlaubspiraten Flüge
    https://www.urlaubspiraten.de/fluge
  3. Urlaubspiraten Reisen
    https://www.urlaubspiraten.de/reisen
  4. Urlaubspiraten Unterkunft
    https://www.urlaubspiraten.de/hotels
  5. Urlaubspiraten Kreuzfahrten
    https://www.urlaubspiraten.de/kreuzfahrten
  6. Urlaubspiraten Sonstiges
    https://www.urlaubspiraten.de/sonstiges
  7. Urlaubspiraten Städtereisen
    https://staedtereisen.urlaubspiraten.de/de-de/gallery/AllDestinations
  8. Urlaubspiraten Flüge
    https://www.urlaubspiraten.de/buchen/flug
  9. Urlaubspiraten Hotels
    https://www.urlaubspiraten.de/buchen/hotel
  10. Urlaubspiraten Mietwagen
    https://www.urlaubspiraten.de/buchen/mietwagen
  11. Urlaubspiraten Kurzreisen
    https://kurzreisen.urlaubspiraten.de
  12. Urlaubspiraten Ferienunterkünfte
    https://holidu.urlaubspiraten.de
  13. Urlaubspiraten Urlaub in Deutschland
    https://www.urlaubspiraten.de/urlaub/deutschland
  14. Urlaubspiraten Strandurlaub
    https://www.urlaubspiraten.de/reisen/strandurlaub
  15. Urlaubspiraten Wellnessurlaub
    https://www.urlaubspiraten.de/reisen/wellnessurlaub
  16. Urlaubspiraten Wochenendtrips
    https://www.urlaubspiraten.de/reisen/wochenendtrip
  17. Urlaubspiraten Griechenland Urlaub
    https://www.urlaubspiraten.de/urlaub/griechenland
  18. Urlaubspiraten Städtereisen
    https://www.urlaubspiraten.de/reisen/staedtereisen
  19. Urlaubspiraten Silvesterreisen
    https://www.urlaubspiraten.de/reisen/silvesterreisen
  20. Urlaubspiraten Wanderurlaub
    https://www.urlaubspiraten.de/reisen/wanderurlaub
  21. Urlaubspiraten Pauschalreisen
    https://www.urlaubspiraten.de/b/buchen/suche
  22. Urlaubspiraten Reisemagazin
    https://www.urlaubspiraten.de/reise-journal
  23. Urlaubspiraten Hotelgutscheine
    https://www.urlaubspiraten.de/uebernachten/hotels/gutschein
  24. Urlaubspiraten Alle Angebote
    https://www.urlaubspiraten.de/
  25. Urlaubspiraten Urlaub im Herbst
    https://www.urlaubspiraten.de/reisen/herbstferien
  26. Urlaubspiraten Reisethemen
    https://www.urlaubspiraten.de/reisen
  27. Urlaubspiraten Unterkunft2 Nächte Ultra All Inclusive im 4° Hotel in Kaprun ab 99€ p.P. | 5 Nächte ab 299€ p.P.ab 99 € p.P.Deal anschauen
    https://www.urlaubspiraten.de/hotels/geniesst-die-zeit-all-inclusive-und-wellness-in-kaprun_58734
  28. Urlaubspiraten ReisenPauschalreisen bis Abreise Oktober 2021 bis zu 2 Wochen vor Abreise kostenfrei stornieren!ab 239 € p.P.Deal anschauen
    https://www.urlaubspiraten.de/reisen/besser-gehts-nicht-kostenfreie-stornierungen_62599
  29. Urlaubspiraten AktuellesDie wichtigsten Infos zum neuen Beherbergungsverbot *UPDATE*Deal anschauen
    https://www.urlaubspiraten.de/aktuelles/alle-infos-zum-neuen-beherbergungsverbot_62575
  30. Urlaubspiraten SonstigesHerbsturlaub in SchwerinIm Herbst noch nichts vor? Ab in die städtische Naturidylle Schwerin!
    https://www.urlaubspiraten.de/reise-journal/schwerin_62545
  31. Urlaubspiraten bis 50% p.P.KreuzfahrtenFür Mitarbeiter und Familien!Bis zu 50% Rabatt auf MSC-Kreuzfahrten für Mitarbeiter*innen im Gesundheitswesen: 8 Nächte Mittelmeer ab 176€
    https://www.urlaubspiraten.de/kreuzfahrten/bis-zu-50-prozent-rabatt-bei-msc-cruises_62617
  32. Urlaubspiraten ab 39,50 € p.P.UnterkunftEntspannung im TaunusEinfach mal durchatmen! ÜF im Taunus inkl. Wellness ab 39,50€ p.P. I Kostenlose Stornierung ✓
    https://www.urlaubspiraten.de/hotels/konigstein-im-taunus-ktc-konigstein_62615
  33. Urlaubspiraten ab 54 € p.P.UnterkunftBesucht doch mal unsere NachbarnKurztrip nach Posen – 2 ÜN im stylischen Apartment mitten in der Altstadt nur 54€ p.P.
    https://www.urlaubspiraten.de/hotels/stylisches-apartment-im-herzen-von-posen_61499
  34. Urlaubspiraten ab 59 € p.P.UnterkunftGutschein für Tropical IslandsDAS perfekte Geschenk! Gutschein für ÜN im Tropical Islands im Safari-Zelt mit Frühstück ab 59€ p.P.
    https://www.urlaubspiraten.de/hotels/es-wird-wieder-tropisch-2-tage-tropical-islands-im-safari-zelt-mit-fruehstueck_48205
  35. Urlaubspiraten ab 110,50 € p.P.UnterkunftEuer eigenes Haus am See2 Nächte im Tiny House für 110,50 € p.P. am Hainer See bei Leipzig  | mit Verfügbarkeiten im Sommer 2021
    https://www.urlaubspiraten.de/hotels/tinyhouse-am-hainer-see_62612
  36. Urlaubspiraten ab 370 € p.P.FlügeFlüge in die Karibik zur besten ReisezeitOhne Flughafenwechsel von Deutschland nach Guadeloupe & Martinique ab 370€
    https://www.urlaubspiraten.de/fluge/endlich-auch-ab-deutschland-fluege-nach-guadeloupe-martinique-schon-ab-400-euro_37837
  37. Urlaubspiraten ab 215 € p.P.ReisenDer Sonne hinterherAuf zum Ende des Stiefels! 1 Woche Apulien samt Flügen & schickem Apartment ab 215€ p.P.
    https://www.urlaubspiraten.de/reisen/bari-city-center-apartments_61868
  38. Urlaubspiraten ab 69,50 € p.P.UnterkunftDas einzige Hotel im UNESCO-WeltkulturerbeDIREKT IN DER SPEICHERSTADT! ÜF in Hamburg im 4° AMERON ab 69,50€ p.P. I kostenloser Storno ✓
    https://www.urlaubspiraten.de/hotels/hotel-ameron-in-der-speicherstadt_54577
  39. Urlaubspiraten ab 2.066 € p.P.ReisenBucht jetzt euren TraumurlaubGÖNNT EUCH HART! 1 Woche Malediven – 5° Resort – Water Villa – All Inclusive – Unterwasser Restaurant – 700€ Ersparnis!
    https://www.urlaubspiraten.de/reisen/50-hotel-neueroeffnung-malediven-wasserbungalow_52241
  40. Urlaubspiraten ab 69 € p.P.UnterkunftHerbst am GardaseeLAST MINUTE an den Gardesee! 5 Nächte im top Apartment am See ab 69€ p.P. (Kein Aufpreis für 4 Personen)
    https://www.urlaubspiraten.de/hotels/sommerferien-am-gardesee-1-woche-im-40-apartment-am-see_56220
  41. Urlaubspiraten ab 144 € p.P.UnterkunftBestpreise im Herbst!5° Hilton Resort & Spa in Swinemünde: 3 Nächte an der poln. Ostsee ab 144€ p.P. mit Frühstück
    https://www.urlaubspiraten.de/hotels/hilton-swinoujscie-resort-spa-swinemunde_59707
  42. Urlaubspiraten AktuellesCorona-NewsErgebnisse vom Berliner Gipfel: Weiter innerdeutsches Chaos, aber international Klarheit
    https://www.urlaubspiraten.de/aktuelles/ergebnisse-vom-berliner-gipfel-innerdeutsches-chaos-und-internationale-klarheit_62613
  43. Urlaubspiraten ab 120 € p.P.UnterkunftOutdoorgoals im AllgäuAllgäu: 3 Nächte im innovativen Hotel inkl. Frühstück ab 120€ p.P. I inkl. Eintritt Swarowski-Kristallwelten
    https://www.urlaubspiraten.de/hotels/allgau-explorer-hotel_62609
  44. Urlaubspiraten ab 1.957 € p.P.ReisenWird das euer Südsee-Abenteuer?FRANZÖSISCH POLYNESIEN! 4 Inseln, 21 Nächte inkl. Flüge + kostenlos stornierbare Unterkünfte für 1.957€
    https://www.urlaubspiraten.de/reisen/inselhupfen-in-der-sudsee-mit-tahiti_62610
  45. Urlaubspiraten ab 37 € p.P.UnterkunftTraut ihr euch?#outdoorgoals Auf zur krassesten Hängebrücke Deutschlands! ÜN + Frühstück ab 37€ p.P.
    https://www.urlaubspiraten.de/hotels/krasseste-hangebrucke-deutschlands_62070
  46. Urlaubspiraten ab 329 € p.P.UnterkunftWintertraum in Berchtesgaden4 Nächte im 4° Hotel in Bad Reichenhall mit Frühstück und Skipass ab 329€
    https://www.urlaubspiraten.de/hotels/4-nachte-im-40-hotel-in-bad-reichenhall-mit-halbpension-und-skipass-ab-389-euro_59881
  47. Urlaubspiraten ab 318 € p.P.ReisenAktuell: 28°C TagestemperaturNoch im Oktober in die Sonne! 1 Woche im 4° Strandresort auf Kos mit All Inclusive ab 318€ I 2 Wochen ab 517€
    https://www.urlaubspiraten.de/reisen/all-in-auf-kos-7-tage-im-4-labaranda-aquapark-ab_42689
  48. Urlaubspiraten Gutscheinaktionen
    https://gutscheine.urlaubspiraten.de
  49. Urlaubspiraten Bus-
    https://www.urlaubspiraten.de/tourismus/busreisen/
  50. Urlaubspiraten Bahnreisen
    https://www.urlaubspiraten.de/reisen/bahnreisen/
  51. Urlaubspiraten Rundreisen
    https://www.urlaubspiraten.de/reisen/rundreisen/
  52. Urlaubspiraten Urlaub
    https://www.urlaubspiraten.de/urlaub/
  53. Urlaubspiraten Newsletter
    https://www.urlaubspiraten.de/newsletter/subscribe
  54. Urlaubspiraten Wellnessurlaube
    https://www.urlaubspiraten.de/reisen/wellnessurlaub/
  55. Urlaubspiraten Wochenendtrips
    https://www.urlaubspiraten.de/reisen/wochenendtrip/angebote/
  56. Urlaubspiraten Partyurlaube
    https://www.urlaubspiraten.de/reisen/partyurlaub/
  57. Urlaubspiraten Angebote für die Sommerferien
    https://www.urlaubspiraten.de/reisen/sommerurlaub/angebote/
  58. Urlaubspiraten Skiurlaube
    https://www.urlaubspiraten.de/reisen/skiurlaub/angebote/
  59. Urlaubspiraten “Suchen & Buchen"-Funktion
    https://www.urlaubspiraten.de/b/buchen/suche
  60. Urlaubspiraten Luxusreisen im Paket
    https://www.urlaubspiraten.de/reisen/luxusreisen/angebote/
  61. Urlaubspiraten Urlaub in der Karibik
    https://www.urlaubspiraten.de/urlaub/karibik/
  62. Urlaubspiraten Reise nach Südamerika
    https://www.urlaubspiraten.de/urlaub/suedamerika/
  63. Urlaubspiraten Urlaub in Tschechien
    https://www.urlaubspiraten.de/urlaub/europa/tschechische-republik/
  64. Urlaubspiraten optimale Städtereise
    https://www.urlaubspiraten.de/reisen/staedtereisen/angebote/
  65. Urlaubspiraten Urlaub in Polen
    https://www.urlaubspiraten.de/urlaub/europa/polen/
  66. Urlaubspiraten Urlaub in der Slowakei
    https://www.urlaubspiraten.de/urlaub/europa/slowakei/
  67. Urlaubspiraten Bratislava
    https://www.urlaubspiraten.de/reisen/staedtereisen/bratislava/
  68. Urlaubspiraten Urlaub in Ungarn
    https://www.urlaubspiraten.de/urlaub/europa/ungarn/
  69. Urlaubspiraten Städtereisen nach Budapest
    https://www.urlaubspiraten.de/reisen/staedtereisen/budapest/
  70. Urlaubspiraten Urlaub in Kroatien
    https://www.urlaubspiraten.de/urlaub/kroatien/
  71. Urlaubspiraten Kroatien-Reisedeals buchen
    https://www.urlaubspiraten.de/reisen/last-minute/kroatien/
  72. Urlaubspiraten Urlaub in Frankreich
    https://www.urlaubspiraten.de/urlaub/frankreich/
  73. Urlaubspiraten Reise ins Disneyland Paris
    https://www.urlaubspiraten.de/reisen/freizeitparks/disneyland-paris/
  74. Urlaubspiraten Urlaub in Ägypten
    https://www.urlaubspiraten.de/urlaub/aegypten/
  75. Urlaubspiraten in Ägypten
    https://www.urlaubspiraten.de/urlaub/aegypten/angebote/
  76. Urlaubspiraten Urlaub auf Mallorca
    https://www.urlaubspiraten.de/urlaub/mallorca/
  77. Urlaubspiraten Günstige Urlaubsangebote haben wir hier
    https://www.urlaubspiraten.de/urlaub/mallorca/angebote/
  78. Urlaubspiraten Urlaub auf den Kanaren
    https://www.urlaubspiraten.de/urlaub/kanaren/
  79. Urlaubspiraten billige Reiseangebote für die Kanaren
    https://www.urlaubspiraten.de/reisen/last-minute/kanaren/
  80. Urlaubspiraten Urlaub in der Türkei
    https://www.urlaubspiraten.de/urlaub/tuerkei/
  81. Urlaubspiraten Traumurlaub zum billigen Preis
    https://www.urlaubspiraten.de/reisen/last-minute/tuerkei/
  82. Urlaubspiraten Urlaub in Portugal
    https://www.urlaubspiraten.de/urlaub/portugal/
  83. Urlaubspiraten Flugvergleich
    https://www.urlaubspiraten.de/buchen/flug
  84. Urlaubspiraten Urlaub in Italien
    https://www.urlaubspiraten.de/urlaub/italien/
  85. Urlaubspiraten schönes Ferienhaus
    https://holidu.urlaubspiraten.de/s/italien
  86. Urlaubspiraten Urlaub Dominikanische Republik
    https://www.urlaubspiraten.de/urlaub/karibik/dominikanische-republik/
  87. Urlaubspiraten Urlaub Kuba
    https://www.urlaubspiraten.de/urlaub/karibik/kuba/
  88. Urlaubspiraten Urlaub Mauritius
    https://www.urlaubspiraten.de/urlaub/mauritius/
  89. Urlaubspiraten Urlaub Thailand
    https://www.urlaubspiraten.de/urlaub/thailand/
  90. Urlaubspiraten Urlaub Marokko
    https://www.urlaubspiraten.de/urlaub/marokko/
  91. Urlaubspiraten Urlaub Südafrika
    https://www.urlaubspiraten.de/urlaub/suedafrika/
  92. Urlaubspiraten Urlaub Italien
    https://www.urlaubspiraten.de/urlaub/italien/
  93. Urlaubspiraten Urlaub Frankreich
    https://www.urlaubspiraten.de/urlaub/frankreich/
  94. Urlaubspiraten Urlaub Island
    https://www.urlaubspiraten.de/urlaub/island/
  95. Urlaubspiraten Urlaub Bali
    https://www.urlaubspiraten.de/urlaub/bali/
  96. Urlaubspiraten Urlaub Europa
    https://www.urlaubspiraten.de/urlaub/europa/
  97. Urlaubspiraten Urlaub Afrika
    https://www.urlaubspiraten.de/urlaub/afrika/
  98. Urlaubspiraten Urlaub Asien
    https://www.urlaubspiraten.de/urlaub/asien/
  99. Urlaubspiraten Urlaub Australien
    https://www.urlaubspiraten.de/urlaub/australien/
  100. Urlaubspiraten Urlaub USA
    https://www.urlaubspiraten.de/urlaub/usa/
  101. Urlaubspiraten Urlaub Südamerika
    https://www.urlaubspiraten.de/urlaub/suedamerika/
  102. Urlaubspiraten Urlaub Mittelamerika
    https://www.urlaubspiraten.de/urlaub/mittelamerika/
  103. Urlaubspiraten Urlaub Südostasien
    https://www.urlaubspiraten.de/urlaub/suedostasien/
  104. Urlaubspiraten Urlaub Südsee
    https://www.urlaubspiraten.de/urlaub/suedsee/
  105. Urlaubspiraten Urlaub im Indischen Ozean
    https://www.urlaubspiraten.de/urlaub/indischer-ozean/
  106. Urlaubspiraten Urlaub Deutschland
    https://www.urlaubspiraten.de/urlaub/deutschland/
  107. Urlaubspiraten Urlaub Indonesien
    https://www.urlaubspiraten.de/urlaub/indonesien/
  108. Urlaubspiraten Urlaub Karibik
    https://www.urlaubspiraten.de/urlaub/karibik/
  109. Urlaubspiraten Urlaub in den Alpen
    https://www.urlaubspiraten.de/urlaub/europa/alpen/
  110. Urlaubspiraten Urlaub am Mittelmeer
    https://www.urlaubspiraten.de/urlaub/europa/mittelmeer/
  111. Urlaubspiraten Urlaub Skandinavien
    https://www.urlaubspiraten.de/urlaub/skandinavien/
  112. Urlaubspiraten Griechische Inseln
    https://www.urlaubspiraten.de/urlaub/griechenland/inselhopping/
  113. Urlaubspiraten Urlaub Ostsee
    https://www.urlaubspiraten.de/urlaub/deutschland/ostsee/
  114. Urlaubspiraten Urlaub Nordsee
    https://www.urlaubspiraten.de/urlaub/deutschland/nordsee/
  115. Urlaubspiraten Urlaub in den VAE
    https://www.urlaubspiraten.de/urlaub/vereinigte-arabische-emirate/
  116. Urlaubspiraten Singlereisen
    https://www.urlaubspiraten.de/reisen/singlereisen/
  117. Urlaubspiraten Kurzurlaub
    https://www.urlaubspiraten.de/reisen/kurzurlaub/
  118. Urlaubspiraten Freizeitparks
    https://www.urlaubspiraten.de/reisen/freizeitparks/
  119. Urlaubspiraten Wochenendtrip
    https://www.urlaubspiraten.de/reisen/wochenendtrip/
  120. Urlaubspiraten Partyurlaub
    https://www.urlaubspiraten.de/reisen/partyurlaub/
  121. Urlaubspiraten Romantikurlaub
    https://www.urlaubspiraten.de/reisen/romantikurlaub/
  122. Urlaubspiraten Strandurlaub
    https://www.urlaubspiraten.de/reisen/strandurlaub/
  123. Urlaubspiraten Flitterwochen
    https://www.urlaubspiraten.de/reisen/flitterwochen/
  124. Urlaubspiraten Musicalreisen
    https://www.urlaubspiraten.de/reisen/musicalreisen/
  125. Urlaubspiraten Urlaub Dubai
    https://www.urlaubspiraten.de/urlaub/dubai/
  126. Urlaubspiraten Urlaub Bahamas
    https://www.urlaubspiraten.de/urlaub/karibik/bahamas/
  127. Urlaubspiraten Urlaub Portugal
    https://www.urlaubspiraten.de/urlaub/portugal/
  128. Urlaubspiraten Urlaub Sardinien
    https://www.urlaubspiraten.de/urlaub/italien/sardinien/
  129. Urlaubspiraten Urlaub Bulgarien
    https://www.urlaubspiraten.de/urlaub/bulgarien/
  130. Urlaubspiraten Urlaub Malediven
    https://www.urlaubspiraten.de/urlaub/malediven/
  131. Urlaubspiraten Urlaub Malta
    https://www.urlaubspiraten.de/urlaub/malta/
  132. Urlaubspiraten Urlaub Mexiko
    https://www.urlaubspiraten.de/urlaub/mexiko/
  133. Urlaubspiraten Urlaub Zypern
    https://www.urlaubspiraten.de/urlaub/zypern/
  134. Urlaubspiraten Urlaub Kroatien
    https://www.urlaubspiraten.de/urlaub/kroatien/
  135. Urlaubspiraten Städtereise Prag
    https://www.urlaubspiraten.de/reisen/staedtereisen/prag/
  136. Urlaubspiraten Städtereise London
    https://www.urlaubspiraten.de/reisen/staedtereisen/london/
  137. Urlaubspiraten Städtereise Barcelona
    https://www.urlaubspiraten.de/reisen/staedtereisen/barcelona/
  138. Urlaubspiraten Städtereise Rom
    https://www.urlaubspiraten.de/reisen/staedtereisen/rom/
  139. Urlaubspiraten Städtereise Berlin
    https://www.urlaubspiraten.de/reisen/staedtereisen/berlin/
  140. Urlaubspiraten Städtereise Amsterdam
    https://www.urlaubspiraten.de/reisen/staedtereisen/amsterdam/
  141. Urlaubspiraten Städtereise New York
    https://www.urlaubspiraten.de/reisen/staedtereisen/new-york/
  142. Urlaubspiraten Städtereise Lissabon
    https://www.urlaubspiraten.de/reisen/staedtereisen/lissabon/
  143. Urlaubspiraten Städtereise Paris
    https://www.urlaubspiraten.de/reisen/staedtereisen/paris/
  144. Urlaubspiraten Städtereise Wien
    https://www.urlaubspiraten.de/reisen/staedtereisen/wien/
  145. Urlaubspiraten Buchungs-AGB
    https://www.urlaubspiraten.de/tourismus/anbieter/ueber-uns/buchungs-agb/
  146. Urlaubspiraten Datenschutz
    https://www.urlaubspiraten.de/tourismus/anbieter/ueber-uns/datenschutzhinweise/
  147. Urlaubspiraten Impressum
    https://www.urlaubspiraten.de/tourismus/anbieter/ueber-uns/impressum/
  148. Urlaubspiraten Kontakt
    https://www.urlaubspiraten.de/tourismus/anbieter/ueber-uns/kontakt/
  149. https://www.urlaubspiraten.de/feed
    https://www.urlaubspiraten.de/feed

Keyword Cloud for Urlaubspiraten.de

gnstigesunsereinternetseiner u003cavielpreise frentscheideninfosflgegebtkurzerichtigergebnissebilligenes eineneine passendeeuropaswochen voreinfachist dertraumhaftenihr bei unsfindet ihraberber dieimmerdamit aucheuch dabeikeinennchstenlanddie u003casuchteine reisewir helfen euchdaallerdings sindtaggnstig buchenwichtigsten infoszeit amauerdemzeitzu euremfrageam meerganznewsletterunsererdie besten schnppchenimkostennchtepassendenweiterenur eineumwochehabentagesaktuellsolleinenbei derihr mit unserenheutespaauswahlklicktweltmeerestartupkann esschnellkeineaber auchunseremaber nichtendefr gnstigedassdie gnstigstenunterknftegnstig urlaubflgenmindestenszu denihr einhatlastminuteangebotetippsmeistsehtwenn ihrdiesen4nmlicheine reise wertdurchforstetmit unsdannflugeinigeihr auchurlaubernur nochwolltpassworthabteurozur1euerkannist diewiranderenso gut wieseid ihrden groeneinen urlaubdelpauschalreisengehtpreisgibtknnt ihr beimit unserennach denwenn ihr einmaldie sonnewohlauf der suchenach budapesterstesdenngnstigmehreredielohntsind unsereauf derder suche nachrechtauchberliner startupentferntdubudapestgibt esoder einewerden euchlasturlaub buchendealsgefundennochbis hin zudie verschiedenenkommthin zuein u003camuss man einfachpiratenerror faresdie urlaubspiratenwenn dasmit kindernerstenhelfeneurendirektsindpreisevielegyptenwerdetkurzurlauboderweiterhabt ihrjedesparenende desauch dasmittendeutschlandim 4wirklichinclusivegeradenchte imziehenpauschalreiseder lufthansameerunterkunftbuchungnoch nichthotel direkteinfach malvornichtsmehrmanwiemit traumhaftendie erstenbesondersdie preise3unterwegswellnesswir urlaubspiratenegalverschiedenstenurlaubspiraten sindsowieso gutwie etwaihr knntknntso knntortihr danndenisteurerperfektereisedes internetsangebotensuchenmeistensreise wertherbstihr einfachstrandurlauboder auchkaribikall inclusivewerdet ihrbieten diemanchmaleckenfrhstckauch diefaresihr mitunseren newsletterseid aufwochenholidaypirateskategoriebilligfliegernauch nochbuchtbestenfr euchflughfenbei densich auchim sommerseitdazudurchtollelegeneinzigeuntereheralsauch einim u003cagutereedereienbietetdamitberbeispielteamampeuchangeboteihr beiwir urlaubspiraten sindauf einenbeliebtestengut wielast minutefndigreiseschnppchen5alleseigentlicheine derzumdichfunktioniertlufthansaeuredenenbestecruiseshostelgnstigeschnppchenleiderausallpolynesienman einfachmit demnatrlicheinmountainvergleichenmal wiederppseindas2 wochennchstebei demwir hierder5 nchteden urlaubbilligallerdingsdie bestenwennwareneine kurzedesjetztwiedernewdoch maldemfindet ihr beider suchebuchenu003cstrongangebotinformationennicht immermuss nicht immereineserrorvommit frhstckschautfindetwelchemjetzt eurenzum beispieleinem u003cathemamit eurenstrndeeine kreuzfahrtdochesnur eine kurzenach den bestenholidaypirates poweredpreiswertepoweredetwaswobesten schnppchenunsere u003caimmer aufdaher3 nchtepragngroenryanairurlaubstippsverschiedenensounsschaut dochu003caseevondeutschenpirate picksgenaubesserurlaubsschnppchennicht nurkurzurlaub mit kindernmittlerweilekommt ihregal obkleinesdie preise frgutallemhaben wirabflughafeneinmalappwerberlinerallepickseinen dealobenmonatekindernregelaufgabegepcktropicaljedochsind dieglckvielenweltgernejedernoch zuindividuellerihr dieoftzustadtobnutzenabfluglustbeieinemstdtensonnefr einedie suchfelderknnt ihr auchsommerkeinen dealsuchfelderknnt ihr mitsiepreiswertwichtigstenden besteneinedealist esfjedenpiratedes hotelsoder u003cavor ortmglichbei unssolltefrnurliebenmusstollennichteuch einfachhierunsere piratesehrkostenlosefr eindirekt buchenlangeferienwohnungendas allesseiteso knnt ihrpreisleistungsverhltnishamburgunterscheidenseht ihrresortschiffdiesesind die preisepassendewreim 4 hoteles sichganzenauch superihr aufbeachdie bestereistwirddie ergebnissegibtsihr werdetgar nichtdas hoteleine u003cakreuzfahrtenfr eineninklhotelsuche nachbilligerreisezielalsokreuzfahrtschiffuns eines auchdurch diestrandinformationen zumitzu einemweltweitsuchehotelsmachtgnstigstensucht euchfindenlangstreckenflgeapartmentdabeiihr hiernennenlust aufzieleaufinselnreisezielefindet hier4 hoteldafrwert aufabreisefrhstck abschnstenostseetopder regelauf deneuremkreuzfahrtsichbieten0urlaubsangeboteum deneuch dievor abflugammietwagenhaben wir hierknnt ihrwir helfenbuchensind wirfr jeden2easyjet1 wocheetwahelfen euchhoteldealsangebote frihrdiesauswhlenrichtigeeinerunserenurlaubspiratenimmer einekeinsuche nach denfr allegnstigenrichtigenfilternauch noch zuurlaubgnstigsten flgeauf demgarinspirationdie zubissuperwertabminutebekommtschonfr dieein kleinesimmer mehrkann manseidn imjehinkosten meistnicht zuwerdenjabrauchtherzoktobernachselbstohnemit einemdieserdeals from holidaypirateswintermachenmchteentspanntalles was dasverzichtendortmuss manmuss nichtwir dieam bestengutesbis hinhelfen euch dabeidestinationenkurzurlaub mitbegehrtfliegenreisenvor allemmit unsererseid auf der

Longtail Keyword Density for Urlaubspiraten.de

KeywordsOccurences
der suche nach11
auf der suche11
ihr bei uns7
bis hin zu6
ihr mit unseren6
findet ihr bei5
im 4 hotel4
wir urlaubspiraten sind4
seid auf der4
nach den besten4
suche nach den4
sind die preise4
muss man einfach4
deals from holidaypirates4
so gut wie4
kurzurlaub mit kindern4
wir helfen euch4
knnt ihr mit4
helfen euch dabei4
alles was das4
so knnt ihr4
knnt ihr bei3
knnt ihr auch3
eine reise wert3
haben wir hier3
auch noch zu3
nur eine kurze3
die preise fr3
muss nicht immer3
die besten schnppchen3
wenn ihr ein3
knnt ihr24
wenn ihr19
fr die15
fr euch15
auf der14
gibt es14
bei uns13
all inclusive12
der suche12
findet ihr12
suche nach11
zum beispiel10
mit dem10
ihr bei9
sind die9
im 48
mit unseren8
ihr mit8
nchte im8
haben wir7
gnstig urlaub7
die preise7
einen deal7
aber auch7
zu den7
eine reise7
die urlaubspiraten7
den besten7
die besten7
fr einen6
zu eurem6
doch mal6
frhstck ab6
hin zu6
die gnstigsten6
bis hin6
ihr auch6
euch dabei6
keinen deal6
ber die6
ihr die6
angebote fr6
wir urlaubspiraten6
1 woche6
die ergebnisse5
ist die5
euch einfach5
auf dem5
auf einen5
euch die5
nach budapest5
mit einem5
oder u003ca5
im sommer5
vor ort5
muss man5
die ersten5
vor allem5
ihr hier5
mit frhstck5
am besten5
wir hier5
fr jeden4
auch super4
nur eine4
mit traumhaften4
kommt ihr4
ende des4
auf den4
kann es4
immer auf4
mal wieder4
einem u003ca4
seid auf4
seid ihr4
ist es4
ihr dann4
vor abflug4
4 hotel4
auch die4
nach den4
aber nicht4
5 nchte4
2 wochen4
pirate picks4
unsere pirate4
nicht immer4
nur noch4
auch ein4
die u003ca4
ein u003ca4
lust auf4
nicht zu4
oder eine4
kosten meist4
holidaypirates powered4
das alles4
fr ein4
noch zu4
urlaubspiraten sind4
informationen zu4
berliner startup4
wir die4
gut wie4
ihr knnt4
kurzurlaub mit4
so gut4
mit kindern4
wir helfen4
n im4
so knnt4
helfen euch4
durch die4
direkt buchen4
3 nchte4
um den4
ihr ein4
error fares4
wie etwa4
man einfach4
ist der3
noch nicht3
es auch3
es einen3
eine kreuzfahrt3
eine passende3
den groen3
bei den3
eine der3
sind wir3
der regel3
fr alle3
sind unsere3
die beste3
oder auch3
des hotels3
habt ihr3
wert auf3
im u003ca3
einer u003ca3
zu einem3
die sonne3
nicht nur3
die zu3
ihr auf3
mit uns3
fr eine3
ein kleines3
einfach mal3
schaut doch3
das hotel3
jetzt euren3
bei dem3
sich auch3
wochen vor3
muss nicht3
uns ein3
eine kurze3
die verschiedenen3
ihr werdet3
reise wert3
immer eine3
am meer3
urlaub buchen3
gnstig buchen3
damit auch3
fr gnstige3
auch das3
wenn das3
allerdings sind3
mit unserer3
wichtigsten infos3
preise fr3
zeit am3
des internets3
findet hier3
besten schnppchen3
immer mehr3
ihr einfach3
gnstigsten flge3
der lufthansa3
unseren newsletter3
bei der3
seht ihr3
werdet ihr3
werden euch3
bieten die3
die suchfelder3
kann man3
es sich3
einen urlaub3
egal ob3
last minute3
eine u003ca3
unsere u003ca3
auch noch3
gar nicht3
mit euren3
sucht euch3
hotel direkt3
den urlaub3
die172
ihr120
fr110
mit95
u003ca93
der93
im85
zu77
oder71
den68
auf64
auch63
das62
ist61
euch57
ein55
wir48
eine47
sind45
bei42
nach42
es40
ab39
nicht38
noch38
einen37
knnt37
am36
einfach32
hier31
wenn30
von30
dem29
aber28
urlaub28
uns28
gnstig27
zum27
unsere27
besten26
nur24
wie24
so23
immer22
hotel21
vor21
urlaubspiraten21
angebote21
mal20
deals20
gibt20
findet19
flge19
dann19
nchte19
man18
haben18
einem17
unseren17
mehr17
kann16
ber16
deal16
hotels15
sein15
um15
direkt15
als15
sich15
buchen15
pp14
bis14
gnstigen14
all14
suche14
schnell13
dabei13
denn13
alle13
viele13
013
euren13
113
inclusive12
des12
schnppchen12
ob12
seid12
beispiel11
unserer11
reise11
gnstige11
alles11
natrlich11
also11
viel11
unter11
preise10
eurem10
damit10
sucht10
kommt10
jetzt10
allerdings10
frhstck9
gut9
werden9
ganz9
aus9
meist9
diese9
einer9
schon9
auerdem9
kein9
oft9
woche8
inkl8
doch8
dass8
euro8
gerade8
buchung8
tipps8
preis8
habt8
bieten8
zeit8
bucht8
etwa8
powered8
muss8
reiseschnppchen8
hat8
groen8
gnstigsten8
besonders7
angebot7
allem7
berliner7
wert7
wo7
flug7
27
piraten7
vom7
deutschland7
ja7
hin7
eure7
wer7
reisen7
sommer7
wieder7
keinen7
ort7
kurzurlaub7
super6
werdet6
sie6
pirate6
europas6
du6
wollt6
sollte6
passwort6
ergebnisse6
selbst6
welt6
zur6
resort6
dieser6
n6
sowie6
sonne6
finden6
jeden6
wochen6
destinationen6
billig6
36
nchsten6
auswahl6
anderen6
apartment6
richtige5
unterknfte5
unserem5
wird5
euer5
richtigen5
richtig5
schaut5
45
sparen5
minute5
land5
team5
ende5
diesen5
machen5
gar5
see5
passende5
budapest5
amp5
tagesaktuell5
besser5
auswhlen5
abreise5
dazu5
macht5
helfen5
kreuzfahrten5
verschiedenen5
oben5
genau5
kreuzfahrt5
herbst5
dich5
sehr5
schiff5
ersten5
filtern5
55
einige5
seite5
informationen5
pauschalreisen5
urlaubsschnppchen5
beliebtesten5
entspannt4
kreuzfahrtschiff4
soll4
lust4
eurer4
picks4
schnsten4
angeboten4
tag4
mittlerweile4
seht4
manchmal4
reist4
ryanair4
billigfliegern4
dort4
vergleichen4
deutschen4
ziele4
gefunden4
nmlich4
braucht4
mindestens4
jede4
abflug4
pauschalreise4
da4
holidaypirates4
urlauber4
begehrt4
passenden4
durch4
klickt4
reiseziel4
abflughafen4
mchte4
individueller4
etwas4
ecken4
wre4
verschiedensten4
kosten4
tollen4
newsletter4
error4
kindern4
weltweit4
heute4
startup4
tolle4
lieben4
nchste4
weiter4
spa4
perfekte4
tropical4
f4
nichts4
oktober4
gibts4
urlaubstipps4
fares4
app4
fliegen4
ohne4
traumhaften4
gute4
billigen4
denen4
stdten4
jedoch3
hamburg3
mglich3
top3
dafr3
meer3
kategorie3
jeder3
wirklich3
ostsee3
einmal3
flgen3
weitere3
billiger3
mehrere3
je3
gypten3
polynesien3
unterscheiden3
keine3
inseln3
thema3
daher3
einzige3
karibik3
infos3
cruises3
kurze3
recht3
gebt3
unterkunft3
reedereien3
fndig3
eines3
entfernt3
ganzen3
ferienwohnungen3
meistens3
preis-leistungsverhltnis3
herz3
vielen3
lohnt3
wellness3
kostenlose3
legen3
strandurlaub3
mitten3
bietet3
beste3
wichtigsten3
unterwegs3
monate3
urlaubsangebote3
mietwagen3
eigentlich3
dies3
suchen3
welchem3
suchfelder3
funktioniert3
nutzen3
verzichten3
aufgabegepck3
beach3
lufthansa3
entscheiden3
egal3
erstes3
last3
buchenu003cstrong3
winter3
mountain3
del3
ziehen3
last-minute-angebote3
weltmeere3
gerne3
glck3
eher3
stadt3
new3
strnde3
preiswerte3
regel3
internets3
seit3
waren3
lange3
easyjet3
gnstiges3
flughfen3
geht3
langstreckenflge3
hostel3
leider3
reiseziele3
prag3
bekommt3
gutes3
kleines3
strand3
frage3
durchforstet3
nennen3
wohl3
inspiration3
hotel-deals3
preiswert3

Who hosts Urlaubspiraten.de?

Urlaubspiraten.de Hosting Provider Information

Hosted IP Address:104.20.208.118
Hosted Hostname:104.20.208.118
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
CloudFlare, Inc.
1.2102%

HTTP Header Analysis for Urlaubspiraten.de

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Thu, 15 Oct 2020 21:58:13 GMT
Content-Length: 0
Connection: keep-alive
Location: https://www.urlaubspiraten.de/
CF-Cache-Status: DYNAMIC
cf-request-id: 05cfde60980000e688a5805000000001
Server: cloudflare
CF-RAY: 5e2ccce0fc43e688-LHR

Urlaubspiraten.de Domain Nameserver Information

HostIP AddressCountry
bill.ns.cloudflare.com 108.162.193.74
elaine.ns.cloudflare.com 173.245.58.152


Need to find out who hosts Urlaubspiraten.de?


Domain Registration (WhoIs) information for Urlaubspiraten.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: urlaubspiraten.de
Nserver: bill.ns.cloudflare.com
Nserver: elaine.ns.cloudflare.com
Status: connect
Changed: 2018-02-14T16:37:32+01:00

Websites with Similar Names

Urlaub-101.de
Wilkommen - Urlaub101
Urlaub-abc.de
Ferienwohnungen & Ferienhäuser Ostsee | Urlaub-abc.de
Urlaub-afrika-reisen.de
Afrika - Reisen & Urlaub - Afrika
Urlaub-all-inclusive.biz
URLAUB ❤ all-inclusive • So macht Urlaub Spass! Jetzt buchen!
Urlaub-am-gruenen-see.com
Diese Domain wurde geparkt | World4You
Urlaub-am-kaiserstuhl.de
Weingut Düringer - Edle Weine aus Ihringen am Kaiserstuhl
Urlaub-am-meer.online
Checkdomain Parking - www.urlaub-am-meer.online

Recently Updated Websites

Harbingerbay.com 1 minute 46 seconds ago.Prepguidance.com 2 minutes 2 seconds ago.Abedinglobal.com 3 minutes 1 second ago.Escueladeciberpadres.com 3 minutes 37 seconds ago.Lacorallina.com 3 minutes 40 seconds ago.Jardin-aline.com 3 minutes 44 seconds ago.Abaacademyinc.com 3 minutes 44 seconds ago.Italicacademy.com 5 minutes 41 seconds ago.Dubaiselskab.com 5 minutes 44 seconds ago.Davidfrench.net 5 minutes 57 seconds ago.Kerfton.com 6 minutes ago.Macdonaldfestival.com 6 minutes 17 seconds ago.Skydivefilm.com 6 minutes 19 seconds ago.Premierfencingutah.org 6 minutes 27 seconds ago.Bestsellingof.com 6 minutes 28 seconds ago.Vermontweddingassociation.com 6 minutes 28 seconds ago.Mtryrapecrisis.org 6 minutes 28 seconds ago.Humastery.com 6 minutes 28 seconds ago.Generalpaneltn.com 7 minutes 21 seconds ago.Gioithieuduan.com 7 minutes 27 seconds ago.Comprehensivetax.net 7 minutes 33 seconds ago.Muskokadatascience.com 7 minutes 41 seconds ago.Uominivideo.com 8 minutes 49 seconds ago.Amisuntrail.bike 8 minutes 51 seconds ago.Boelsoccasion.com 8 minutes 54 seconds ago.Iambrony.com 9 minutes 37 seconds ago.Yasalam.com.sa 9 minutes 45 seconds ago.Islandwatersportsny.com 9 minutes 52 seconds ago.Tradeshowconsultants.com 9 minutes 58 seconds ago.Marbitzin.com 9 minutes 59 seconds ago.