USA Rugby | The OFFICIAL Website

Safety: Low trust score
Year Founded: 1996
Global Traffic Rank: 159,617
Estimated Worth: $71,400
Category: Sports > Rugby

The official website of the national governing body for the sport of rugby union in the United States of America. USA Rugby is charged with developing the game on all levels and has over 125,000 active members. USA Rugby oversees four national teams, multiple collegiate and high school All-American sides, and an emerging Olympic development path...



Domain summary

Last updated
2020-10-27
Domain label
usarugby
Domain extension
org
Domain registered:
1996-11-09
Domain updated:
2020-10-27
Global Traffic Rank
159,617
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$71,400
Estimated daily income
$119
Estimated monthly income
$3,620

Frequently Asked Questions (FAQ)

Q: When was Usarugby.org registered?
A: Usarugby.org was registered 24 years, 7 months, 1 week, 1 day, 1 hour, 46 minutes, 14 seconds ago on Saturday, November 9, 1996.
Q: When was the WHOIS for Usarugby.org last updated?
A: The WHOIS entry was last updated 7 months, 3 weeks, 1 hour, 46 minutes, 14 seconds ago on Tuesday, October 27, 2020.
Q: What are Usarugby.org's nameservers?
A: DNS for Usarugby.org is provided by the following nameservers:
  • ns11.worldnic.com
  • ns12.worldnic.com
Q: Who is the registrar for the Usarugby.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Usarugby.org?
A: Usarugby.org ranks 159,617 globally on Alexa. Usarugby.org has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Usarugby.org each day?
A: Usarugby.org receives approximately 9,497 visitors and 47,485 page impressions per day.
Q: What IP address does Usarugby.org resolve to?
A: Usarugby.org resolves to the IPv4 address 72.249.108.19.
Q: In what country are Usarugby.org servers located in?
A: Usarugby.org has servers located in the United States.
Q: What webserver software does Usarugby.org use?
A: Usarugby.org is powered by NetDNA-cache/2.2 webserver.
Q: Who hosts Usarugby.org?
A: Usarugby.org is hosted by Colo4, LLC in United States.
Q: How much is Usarugby.org worth?
A: Usarugby.org has an estimated worth of $71,400. An average daily income of approximately $119, which is roughly $3,620 per month.

Usarugby.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Usarugby.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Usarugby.org

H1 Headings

0 :

H2 Headings

1 :
  1. PLEASE NOTE

H3 Headings

19 :
  1. Latest Results & Upcoming Matches
  2. Get Involved with Rugby
  3. USA Rugby TV Latest Latest from USA Rugby TV View more 
  4. From the USA Rugby Community | Black Lives Matter
  5. A message from the USA Rugby Board of Directors | 2020-21 Season
  6. Women's Sevens Webinar | Aspects of Play
  7. Chow Down With the Dawgs | Ben Pinkelman hosts Matai Leuta
  8. Women's Sevens Webinar | Working with a Team
  9. Chow Down with the Dawgs | Ben Pinkelman hosts Kevon Williams
  10. Play Rugby Today | USA Rugby
  11. Women's Sevens Webinar | Olympic Campaign
  12. Chow Down with the Dawgs | Danny Barrett hosts Stephen Tomasin
  13. Women's Sevens Webinar | Cohesion & Culture
  14. USA Sevens Malon Al-Jiboori Makes Candles
  15. BetweenThePosts #11: Self-Quarantined, USA Rugby competition suspension, At-Home workouts +more
  16. Competition Mgmt. System Help: CMS Resources
  17. Public rosters, registration, waivers, etc: Membership FAQs
  18. Webpoint: Membership FAQs
  19. Learning Management System: Click Here

H4 Headings

1 :
  1. The Digital Platform Department cannot respond to enquiries regarding the following platforms as each are managed by a different USA Rugby department.

H5 Headings

20 :
  1. October 22, 2020
  2. October 19, 2020
  3. October 19, 2020
  4. October 14, 2020
  5. October 14, 2020
  6. October 9, 2020
  7. October 8, 2020
  8. October 7, 2020
  9. September 28, 2020
  10. September 25, 2020
  11. September 24, 2020
  12. September 21, 2020
  13. September 18, 2020
  14. September 18, 2020
  15. September 18, 2020
  16. September 16, 2020
  17. September 11, 2020
  18. September 11, 2020
  19. September 11, 2020
  20. September 4, 2020

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

267 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

41:

Links - Internal (nofollow)

0:

Links - Outbound

371:

Links - Outbound (nofollow)

6:

Keyword Cloud for Usarugby.org

pleasechrisinternshipstephenrugby hallul1s bothdawgs beneducationben pinkelman hostsuniond1coach chrisrugby world cuptieronesponsorsprosponsorgrouptapcontainerheader siteheader leftsmallheaderinduction ceremonywebinars ledpinkelmaneye scout2020usa rugbymenuitemimagenewsmen8217shamburgerboardwantu003cbr u003enu003cbrtapcontainerheaderpinkelman hosts2hosts mataiusa womensrugby foundationmalonjobceremonynothead coach038webinarhelpyoutiertwosponsorsprosponsorgrouptransgender4s0coordinator jobcoach chris brownhostshall of famelivehassiteheader tapcontainerheadertraining 038 educationsquadcoachessevens webinarstateshosts kevonowldots038 education2020women8217seagle eye scoutinnerbottomwrapper3pxactivecoordinator25smobilefilters togglefilterspaperbuttonwomenssquadcoaches 038regionaleasechris browneaglefour webinars led7s bothfdropdownfopendropdown menuitemimage2020 uspathwayskevon2020usamatai5sscout regional coordinatorworld rugbyregional coordinator jobannouncesfdropdownfopendropdownsubnavrugby high performanceallamericandawgs ben pinkelmanchow downwomens sevens webinarjunior nationalscout regionalusa womens sevensdawgsu003enu003cbrkatesubnav ddhovertapcontainerheader siteheaderusa rugby boardbenfourdevelopmentcompetitionbarrett hostsworld cuprugby training 038sitemapli ulfour webinarsliactivealjibooriteamabodynotaboutusarugbynationaloffice subnavnewswomen8217s2020theusus rugby foundationeaseowlcarouselsiteheader leftsmallheaderlieagleseyecommunitypinkelman hosts kevonben pinkelmanprimarymenuusa rugbysiteheader leftsmallheader siteheadermembersrugby highrugby communitybarrettrugby boardmalon aljibooricoachmobilefilterssitemapliweeklyscreenrugby worldu003cbrrugby trainingeagle eyeowlstageouterperformance pathwaystraining 038american rugbyresultsplayereye scout regionalmenuitemimagealedhigh performancevirtual1shigh performance pathwaysyour038 resultsplayer4subnav ddyour supportgetus rugbyshowtrainingamericasolideaglesmen8217s7sxvssevenswomen8217sfame inductioninnerbottomwrapper sitesponsorsshowformediumdownsevens2020 us rugbyregional coordinatormenuitemimagea shadowowlitemabodynotaboutusarugbynationalofficesupportgetsportrugbydivisionhosts stephencuphighdown5s easehallwomens sevensworldprimarymenu limobilemenutierthreesponsorsprosponsorgroupshow on instagramscreen and minwidth64emnational developmentinductionusabothddhovertogglefilterspaperbuttonsitesponsorsshowformediumdownhead coach chriswebinarsheadshadow0importantsponsorsled by headpolicy3owlnavinstagram livemensleftsmallheader siteheaderreportjunior1pxautoimportantsponsorsddstates of americaolympicleftsmallheaderchowperformanceeasetransitionopacityamericansiteheader tapcontainerheader siteheader1siteheaderus rugby hallmorebarrett hosts stephendirectorsbrownplaypinkelman hosts mataiinstagramreturnnationalfoundation1px 0scoutfameminwidth64em

Longtail Keyword Density for Usarugby.org

KeywordsOccurences
rugby world cup8
eagle eye scout6
us rugby hall6
hall of fame6
eye scout regional4
led by head4
ben pinkelman hosts4
dawgs ben pinkelman4
womens sevens webinar4
regional coordinator job4
scout regional coordinator4
head coach chris4
rugby training 0384
usa rugby board4
training 038 education4
2020 us rugby4
us rugby foundation4
high performance pathways4
rugby high performance4
coach chris brown4
usa womens sevens4
four webinars led4
states of america3
screen and min-width64em3
barrett hosts stephen3
pinkelman hosts kevon3
pinkelman hosts matai3
site-header tap-containerheader site-header3
site-header left-smallheader site-header3
tap-containerheader site-header left-smallheader3
show on instagram3
usa rugby19
us rugby10
world rugby8
womens sevens8
world cup8
rugby world8
sevens webinar8
2020usa rugby7
high performance6
pinkelman hosts6
eagle eye6
eye scout6
rugby hall6
head coach6
5s ease5
abodynotabout-usa-rugby-national-office sub-nav5
primary-menu li5
rugby board4
scout regional4
regional coordinator4
usa womens4
coordinator job4
four webinars4
chris brown4
1s both4
coach chris4
webinars led4
national development4
chow down4
dawgs ben4
ben pinkelman4
7s both4
038 resultsplayer4
038 education4
u003cbr u003enu003cbr4
junior national4
sub-nav ddhover4
training 0384
sub-nav dd4
mobile-filters toggle-filterspaper-button4
your supportget4
rugby high4
performance pathways4
rugby foundation4
2020 us4
induction ceremony4
fame induction4
rugby training4
instagram live3
site-mapli ul3
1px 03
menu-item-imagea shadow3
f-dropdownf-open-dropdown menu-item-image3
inner-bottom-wrapper site-sponsorsshow-for-medium-down3
squadcoaches 0383
malon al-jiboori3
hosts stephen3
barrett hosts3
hosts kevon3
site-header tap-containerheader3
tap-containerheader site-header3
site-header left-smallheader3
left-smallheader site-header3
rugby community3
american rugby3
hosts matai3
rugby86
usa31
03822
screen20
sevens19
inner-bottom-wrapper18
world16
sub-nav14
mobile-filters12
national12
012
womens11
us11
li10
hosts10
eagles10
ease9
site-header9
solid9
webinar8
high8
tier-onesponsorspro-sponsor-group8
7s8
coach8
both8
cup8
2020usa8
you7
5s7
17
down7
tier-twosponsorspro-sponsor-group7
dawgs7
scout6
job6
performance6
1s6
head6
hamburger6
hall6
fame6
virtual6
induction6
pinkelman6
your6
training6
regional6
eagle6
eye6
chris5
owl-item5
development5
owl-nav5
25
please5
four5
u003enu003cbr5
primary-menu5
menu-item-imagea5
division5
abodynotabout-usa-rugby-national-office5
coordinator4
25s4
toggle-filterspaper-button4
chow4
1px4
supportget4
ben4
olympic4
site-mapli4
d14
34
tier-threesponsorspro-sponsor-group4
4s4
resultsplayer4
owl-dots4
eaglesmen8217s4
states4
members4
webinars4
led4
brown4
weekly4
u003cbr4
junior4
report4
ddhover4
announces4
foundation4
dd4
sport4
menu-item-image4
internship4
education4
play4
transgender4
kate4
board4
ceremony4
pathways4
directors4
mens3
3px3
easetransitionopacity3
easeowl-carousel3
tap-containerheader3
left-smallheader3
2020the3
america3
union3
all-american3
has3
owl-stage-outer3
newswomen8217s3
not3
return3
newsmen8217s3
show3
instagram3
live3
site-sponsorsshow-for-medium-down3
team3
0importantsponsors3
help3
min-width64em3
liactive3
2020women8217s3
american3
more3
want3
community3
43
shadow3
policy3
f-dropdownf-open-dropdown3
sevenswomen8217s3
squadcoaches3
matai3
kevon3
barrett3
stephen3
malon3
al-jiboori3
competition3
mobile-menu3
ul3
autoimportantsponsors3
xvs3
active3

Who hosts Usarugby.org?

Usarugby.org Hosting Provider Information

Hosted IP Address:72.249.108.19
Hosted Hostname:72-249-108-19.static.directrouter.com
Service Provider:Colo4, LLC
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:NetDNA-cache/2.2

Is "Colo4, LLC" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
Colo4, LLC
0.0811%

HTTP Header Analysis for Usarugby.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 27 Oct 2020 01:09:54 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 119294
Connection: keep-alive
P3P: CP="NOI"
Expires: Thu, 26 Nov 2020 01:09:54 GMT
Cache-Control: max-age=2592000
Pragma: no-cache
Link:; rel="canonical"
Etag: "163098-1603389692;gz"
X-LiteSpeed-Cache: hit
Content-Encoding: gzip
Vary: Accept-Encoding,User-Agent
Alt-Svc: quic=":443"; ma=2592000; v="43,46", h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-25=":443"; ma=2592000, h3-27=":443"; ma=2592000
X-Turbo-Charged-By: LiteSpeed
Server: NetDNA-cache/2.2
Access-Control-Allow-Origin: *
X-Cache: HIT

Usarugby.org Domain Nameserver Information

HostIP AddressCountry
ns11.worldnic.com 162.159.26.214
ns12.worldnic.com 162.159.27.150


Need to find out who hosts Usarugby.org?


Domain Registration (WhoIs) information for Usarugby.org

 Domain Name: USARUGBY.ORG
Registry Domain ID: D4676546-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2019-07-14T06:58:59Z
Creation Date: 1996-09-11T04:00:00Z
Registry Expiry Date: 2024-09-10T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: USA Rugby
Registrant State/Province: CO
Registrant Country: US
Name Server: NS11.WORLDNIC.COM
Name Server: NS12.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-08-30T04:35:17Z

Websites with Similar Names

Usaru315.com
ゆる旅&ワクワクライフ – のんびり島旅、ひとり旅。ネコもいるよ。
Usaruck4vets.com
Empowering Veteran and Active Military Families
Usaruck4vets.net
Empowering Veteran and Active Military Families
Usarufa.bible
usarufa.bible | Bible Society of Papua New Guinea
Usarugby.org
USA Rugby | The OFFICIAL Website

Recently Updated Websites

Sovereignunitedstates.dev (2 seconds ago.)Whfychat.com (3 seconds ago.)Delawarehep.org (4 seconds ago.)Parkplazanursinghome.com (5 seconds ago.)Keisho.info (5 seconds ago.)Modeloff.com (6 seconds ago.)Xrohn.com (7 seconds ago.)Tiptonrealestate.com (7 seconds ago.)Abbyabby.com (7 seconds ago.)Alpharettalegal.com (8 seconds ago.)Theragazzirealtor.net (9 seconds ago.)Zakcomunicazione.net (10 seconds ago.)Everythinglivewest.com (10 seconds ago.)Bartowford.com (11 seconds ago.)Caoid.com (11 seconds ago.)Jersey.com (11 seconds ago.)Coring.build (12 seconds ago.)Timscampscampday.com (12 seconds ago.)Wetraveldifferent.net (13 seconds ago.)Cursosdochef.com (14 seconds ago.)Maritimebus.com (15 seconds ago.)Inpunjab.com (16 seconds ago.)Xrrehab.com (16 seconds ago.)Buildsystemsrls.com (17 seconds ago.)Dkscable.com (19 seconds ago.)Ibuyyourupsidedownhome.com (20 seconds ago.)Koccafe.com (22 seconds ago.)Taretenda.com (24 seconds ago.)Sonsanddaughtersloveyou.com (24 seconds ago.)Njmaritimemuseum.org (24 seconds ago.)

Recently Searched Keywords

broker richard (1 second ago.)message--recognise-user (1 second ago.)электромотоцикл детский от 3 лет (1 second ago.)tozlu giyim tesett (2 seconds ago.)style-jzfaohiu1dropdownmenu a divnth-child2 (2 seconds ago.)16-17.3 inch ve üzeri (3 seconds ago.)melkersson-rosenthal syndrome causes (4 seconds ago.)обзор deadly premonition 2: a blessing in disguise. что с нами стало, зак (4 seconds ago.)liferayonendnavigate function (5 seconds ago.)went out during (5 seconds ago.)3d en madera (7 seconds ago.)httpssklshkaetlynanne (7 seconds ago.)死妹人形 第1章「蘇生」 (8 seconds ago.)get our free  (8 seconds ago.)80-05-63 bank address (9 seconds ago.)www trabalhosfeitos com topicos (9 seconds ago.)景德镇陶瓷茶具 (11 seconds ago.)we at ekklavya (12 seconds ago.)тп ктп рп (12 seconds ago.)muhteem geri (13 seconds ago.)мини-отель «барса» олимпийский парк сочи (14 seconds ago.)publisher - მთავრობის შესახებ ნიუსები (15 seconds ago.)unifamiliare zona (15 seconds ago.)tranny shows (15 seconds ago.)testa fiore (16 seconds ago.)iicn (17 seconds ago.)fazla makale (18 seconds ago.)whole word why (18 seconds ago.)відпочинок в карпатах з басейном все включено (18 seconds ago.)varyb informacija (20 seconds ago.)