Summary  |  United States Citizenship and Immigration Services (USCIS) is a component of the United States Department of Homeland Security (DHS). It performs many administrative functions formerly carried out by the former United States Immigration and Naturalization Service (INS), which was part of the Department of Justice. The stated priorities of the USCIS are to promote national security, to eliminate immigration case backlogs, and to improve customer services. USCIS is headed by a director who reports directly to the Deputy Secretary for Homeland Security.
High trust score  | 
Homepage | USCIS has a High trust score, and a Statvoo Rank of B. is hosted by SunGard Availability Services LP in New York, New York, United States, 10028. has an IP Address of and a hostname of

The domain was registered 201 decades 9 years 3 months ago by , it was last modified 201 decades 9 years 3 months ago and currently is set to expire 201 decades 9 years 3 months ago.

Whois information for

Full Whois Lookup for Whois Lookup

% DOTGOV WHOIS Server ready
Domain Name: USCIS.GOV
Status: ACTIVE

>>> Last update of whois database: 2017-08-31T15:21:30Z

Who hosts Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:SunGard Availability Services LP
Hosted Country:United StatesUS
Location Latitude:40.7762
Location Longitude:-73.9549
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
X-Drupal-Cache: HIT
ETag: "1433770433.068-1"
X-Content-Type-Options: nosniff
X-Frame-Options: SameOrigin
Content-Language: en
Link:; rel="shortlink",; rel="canonical"
X-Generator: Drupal 7 (
Last-Modified: Mon, 08 Jun 2015 13:33:53 GMT
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Type: text/html; charset=utf-8
Content-Length: 14166
Cache-Control: public, max-age=300
Expires: Mon, 08 Jun 2015 14:08:26 GMT
Date: Mon, 08 Jun 2015 14:03:26 GMT
Connection: keep-alive

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:4
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:1
Total Images:20
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

unitedemploymentnaturalizationyour greenactimmigrationyour casetoolsemployment eligibilityvarhttpswwwuscisgovstudentsunited statesworkinglocalvisitimmigration servicespolicyusapplyusciseverifyuscis officegetaugust 31 naturalization31 naturalization informationvisasthroughstatesgreen carddepartment of stateformsauguststatusfamilyneedothercentercardnewscertainapply for citizenshipdepartment of homelandformnaturalization information sessionresource centerofficehomelandcitizenship applyappointmenttypeinformation sessioneligibilitytestresourcecheckcontactpointmyeverifycaseyoumaybenefitonlineaugust 31workerssessionservicecitizenshipstate0learnurlcustomervisanaturalization information31 naturalizationmakeyour green cardfindinformationsecurityrequirementsdepartmenti9greenselfyourhelpapplicantsserviceshomeland securityworkrenewaskiffilepermanentpetition

Longtail Keyword Density for

31 naturalization information4
naturalization information session4
apply for citizenship4
august 31 naturalization4
your green card3
department of state3
department of homeland3
green card14
united states6
your case6
employment eligibility5
august 314
31 naturalization4
naturalization information4
information session4
immigration services4
citizenship apply3
your green3
homeland security3
uscis office3
resource center3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?