Utdallas.edu Favicon Utdallas.edu

Utdallas.edu Website Thumbnail
Checking...
The University of Texas at Dallas
High trust score
 | 
Add a review Change category Claim this site

Domain summary

Domain label
utdallas
Domain extension
edu
Domain registered:
1988-11-10
Domain updated:
2020-09-26
Global Traffic Rank
5,389
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$2,998,080
Estimated daily income
$2,776
Estimated monthly income
$84,437

Rank summary

How is utdallas.edu ranked relative to other sites:

Percentage of visits to utdallas.edu from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Utdallas.edu registered?
A: Utdallas.edu was registered 31 years, 11 months, 2 weeks, 1 day, 10 hours, 20 minutes, 21 seconds ago on Thursday, November 10, 1988.
Q: When was the WHOIS for Utdallas.edu last updated?
A: The WHOIS entry was last updated 4 weeks, 1 day, 10 hours, 20 minutes, 21 seconds ago on Saturday, September 26, 2020.
Q: What are Utdallas.edu's nameservers?
A: DNS for Utdallas.edu is provided by the following nameservers:
  • ns2.ots.utsystem.edu
Q: Who is the registrar for the Utdallas.edu domain?
A: The domain has been registered at EDUCASE.
Q: What is the traffic rank for Utdallas.edu?
A: Utdallas.edu ranks 5,389 globally on Alexa. Utdallas.edu has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Utdallas.edu each day?
A: Utdallas.edu receives approximately 347,003 visitors and 2,776,024 page impressions per day.
Q: What IP address does Utdallas.edu resolve to?
A: Utdallas.edu resolves to the IPv4 address 104.16.43.54.
Q: In what country are Utdallas.edu servers located in?
A: Utdallas.edu has servers located in the United States.
Q: What webserver software does Utdallas.edu use?
A: Utdallas.edu is powered by CloudFlare webserver.
Q: Who hosts Utdallas.edu?
A: Utdallas.edu is hosted by CloudFlare, Inc. in United States.
Q: How much is Utdallas.edu worth?
A: Utdallas.edu has an estimated worth of $2,998,080. An average daily income of approximately $2,776, which is roughly $84,437 per month.

Who hosts Utdallas.edu?

Utdallas.edu Hosting Provider Information

Hosted IP Address:104.16.43.54
Hosted Hostname:104.16.43.54
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Utdallas.edu

Http-Version: 1.1
Status-Code: 302
Status: 302 Found
Date: Sun, 18 Oct 2020 07:51:17 GMT
Content-Length: 0
Connection: keep-alive
Location: https://utdallas.edu/
CF-Cache-Status: DYNAMIC
cf-request-id: 05dc4a0f6400000772e923d000000001
Server: cloudflare
CF-RAY: 5e40ac5f0ad30772-LHR

Utdallas.edu Domain Nameserver Information

HostIP AddressCountry
ns2.ots.utsystem.edu 206.77.62.130United States United States


Need to find out who hosts Utdallas.edu?


WhoIs information for Utdallas.edu

 This Registry database contains ONLY .EDU domains.
The data in the EDUCAUSE Whois database is provided
by EDUCAUSE for information purposes in order to
assist in the process of obtaining information about
or related to .edu domain registration records.

The EDUCAUSE Whois database is authoritative for the
.EDU domain.

A Web interface for the .EDU EDUCAUSE Whois Server is
available at: http://whois.educause.edu

By submitting a Whois query, you agree that this information
will not be used to allow, enable, or otherwise support
the transmission of unsolicited commercial advertising or
solicitations via e-mail. The use of electronic processes to
harvest information from this server is generally prohibited
except as reasonably necessary to register or modify .edu
domain names.

-------------------------------------------------------------

Domain Name: UTDALLAS.EDU

Registrant:
University of Texas at Dallas
800 W. Campbell Rd
ROC 20
Richardson, TX 75080
US

Administrative Contact:
UTD Hostmaster
University of Texas at Dallas
800 W. Campbell Rd.
Richardson, TX Login to show email
Contact:
UTD Hostmaster
University of Texas at Dallas
800 W. Campbell Rd.
Richardson, TX Login to show email
Servers:
NSPHYSEX1.UTDALLAS.EDU
NS2.OTS.UTSYSTEM.EDU
NSFLEXEX1.UTDALLAS.EDU

Domain record activated: 10-Nov-1988
Domain record last updated: 03-Aug-2020
Domain expires: 31-Jul-2021

Utdallas.edu Free SEO Report

Website Inpage Analysis for Utdallas.edu

H1 Headings

2 :
  1. Explore UT Dallas
  2. Explore UT Dallas

H2 Headings

5 :
  1. Coronavirus Updates
  2. UTD Today
  3. Comet Calendar
  4. A-Z Index
  5. Quick Links

H3 Headings

10 :
  1. Exploratory Advising Provides Major Assists for Undeclared Students
  2. Astrophysicists Light Way for More Accurate Model of Universe
  3. Why Do Identical Cells Act Differently? Team Unravels Cellular ‘Noise’ Sources
  4. We Welcome International Students
  5. We Know Transfer Students
  6. Advanced Degrees, Innovative Approaches
  7. Transfer Appreciation Week
  8. Why Diversity Matters in STEM
  9. Women's Summit
  10. Beili Liu: Art, Refugee Policy, Human Rights 

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

22 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

74:
  1. The University of Texas at Dallas
    https://www.utdallas.edu/
  2. Galaxy
    https://galaxy.utdallas.edu
  3. eLearning
    https://elearning.utdallas.edu
  4. Directory
    http://utdallas.edu/directory/
  5. Maps
    http://utdallas.edu/maps/
  6. Give
    https://giving.utdallas.edu
  7. No text
    http://utdallas.edu/index.html
  8. About UTD
    http://utdallas.edu/about/
  9. Admissions
    http://utdallas.edu/admissions/
  10. Academics
    http://utdallas.edu/academics/
  11. Campus Life
    http://utdallas.edu/campuslife/
  12. Research
    http://utdallas.edu/research/
  13. Students
    http://utdallas.edu/current/
  14. Faculty & Staff
    http://utdallas.edu/faculty/
  15. Alumni & Friends
    http://utdallas.edu/alumni/
  16. Visitors & Family
    http://utdallas.edu/visitors/
  17. COVID-19 Updates
    https://www.utdallas.edu/coronavirus
  18. Coronavirus Updates
    https://www.utdallas.edu/covid/
  19. COVID‑19 information webpage
    https://www.utdallas.edu/covid/
  20. Explore UT Dallas
    https://www.utdallas.edu/about/
  21. About UTD
    https://www.utdallas.edu/about/
  22. Take a Virtual Tour
    https://www.utdallas.edu/virtualtour/
  23. Majors & Degrees
    https://www.utdallas.edu/academics/degrees/
  24. UTD Today
    http://utdallas.edu/about/today/
  25. Students & Teaching Exploratory Advising Provides Major Assists for Undeclared Students The Office of Undergraduate Education offers services that help students explore their academic interests and find the path that fits them best.
    https://www.utdallas.edu/news/students-teaching/exploratory-advising-2020/?WT.mc_id=NewsHomePageCenterColumn
  26. Science & Technology Astrophysicists Light Way for More Accurate Model of Universe Dr. Mustapha Ishak-Boushaki and fellow scientists demonstrated the first use of a method called self-calibration to remove contamination from gravitational lensing signals.
    https://utdallas.edu/news/science-technology/astrophysics-gravitational-lensing-2020/?WT.mc_id=NewsHomePageCenterColumn
  27. Science & Technology Why Do Identical Cells Act Differently? Team Unravels Cellular ‘Noise’ Sources Dr. Leonidas Bleris and his colleagues demonstrated that most of the fluctuations in gene expression between identical cells occur in the first step of protein production, called transcription.
    https://www.utdallas.edu/news/science-technology/cellular-noise-bleris-2020/?WT.mc_id=NewsHomePageCenterColumn
  28. More News
    http://utdallas.edu/news/?WT.mc_id=NewsHomePageCenterColumn
  29. No text
    http://utdallas.edu/international/
  30. Find out why students love UTD »
    http://utdallas.edu/international/
  31. No text
    https://www.utdallas.edu/bright/transfer/
  32. Transferring to UTD »
    https://utdallas.edu/bright/transfer/
  33. No text
    https://www.utdallas.edu/bright/grad/
  34. Masters Degrees at UTD »
    https://www.utdallas.edu/bright/grad/
  35. Comet Calendar
    http://utdallas.edu/calendar/
  36. No text
    https://calendar.utdallas.edu/event/transfer_appreciation_week_2020#.X4Rsiud7mUk&WT.mc_id=CalendarHomePage
  37. Transfer Appreciation Week
    https://calendar.utdallas.edu/event/transfer_appreciation_week_2020#.X4Rsiud7mUk&WT.mc_id=CalendarHomePage
  38. No text
    http://utdallas.edu/
  39. No text
    https://calendar.utdallas.edu/event/houston_we_have_a_problem_why_diversity_matters_in_stem_facilitated_by_dr_stephenie_adams#.X4Rs2ed7mUk&WT.mc_id=CalendarHomePage
  40. Why Diversity Matters in STEM
    https://calendar.utdallas.edu/event/houston_we_have_a_problem_why_diversity_matters_in_stem_facilitated_by_dr_stephenie_adams#.X4Rs2ed7mUk&WT.mc_id=CalendarHomePage
  41. No text
    https://calendar.utdallas.edu/search?search=women%27s+summit&WT.mc_id=CalendarHomePage
  42. Women's Summit
    https://calendar.utdallas.edu/search?search=women%27s+summit&WT.mc_id=CalendarHomePage
  43. No text
    https://calendar.utdallas.edu/event/beili#.X4cWX-d7mUk&WT.mc_id=CalendarHomePage
  44. Beili Liu: Art, Refugee Policy, Human Rights 
    https://calendar.utdallas.edu/event/beili#.X4cWX-d7mUk&WT.mc_id=CalendarHomePage
  45. More Events
    http://utdallas.edu/calendar/?WT.mc_id=CalendarHomePage
  46. A-Z Index
    http://utdallas.edu/siteindex/
  47. Academic Calendar
    http://utdallas.edu/academiccalendar
  48. Admissions
    http://utdallas.edu/admissions/information.html
  49. Campus Carry
    http://utdallas.edu/campuscarry/
  50. Career Center
    http://utdallas.edu/career
  51. Centers
    http://utdallas.edu/centers
  52. Course Lookup
    http://utdallas.edu//coursebook.utdallas.edu
  53. Human Resources
    http://utdallas.edu/hr/
  54. International Center
    http://utdallas.edu/ic/
  55. Library
    http://utdallas.edu/library/
  56. Publications
    http://utdallas.edu/publications/
  57. Tuition and Fees
    http://utdallas.edu/tuition
  58. No text
    https://www.utdallas.edu/
  59. View more social accounts >
    http://utdallas.edu/social/
  60. Accessibility
    http://utdallas.edu/accessibility/
  61. Achievements
    http://utdallas.edu/achievements/
  62. Career Center
    http://utdallas.edu/career/
  63. CARES Act Reporting
    https://www.utdallas.edu/finaid/cares-reporting/
  64. Centers
    https://utdallas.edu/centers/
  65. Counseling/Mental Health
    https://utdallas.edu/counseling/
  66. Hazing Prevention and Response
    https://www.utdallas.edu/conduct/hazing/
  67. Human Resources
    https://www.utdallas.edu/hr/
  68. Jobs at UTD
    https://jobs.utdallas.edu/
  69. News Center
    http://utdallas.edu/news/
  70. Nondiscrimination & Title IX
    http://utdallas.edu/institutional-initiatives/title-ix/
  71. Privacy Policy
    http://utdallas.edu/privacy/
  72. Required Links
    http://utdallas.edu/links/
  73. Security, Health, and Safety
    https://utdallas.edu/safety/
  74. Schools
    http://utdallas.edu/academics/schools/

Links - Internal (nofollow)

0:

Links - Outbound

7:
  1. No text
    https://www.facebook.com/utdallas
  2. No text
    https://www.instagram.com/ut_dallas/
  3. No text
    https://twitter.com/ut_dallas
  4. No text
    https://www.youtube.com/user/UTDallasComets
  5. Athletics
    https://utdcomets.com
  6. Texas Veterans Portal
    https://veterans.portal.texas.gov
  7. UT System
    https://www.utsystem.edu/

Links - Outbound (nofollow)

0:

Keyword Cloud for Utdallas.edu

var urlurgentongoingvarurgentminimizerhide urgentinternationalexploreurgent phidestudentseventpreventdefault fbqtrackoctuturgent urgentminimizerhide urgentexpiresuniversitymoreurgentminimizerhide urgent urgentmaximizershowfindfbqtrackacademicdegreesphidewhyskip to mainurl thisattrhref windowopenurlnewswindowopenurlurgent urgentmaximizershoweventtexasurgentminimizerhidethisattrhref windowopenurlutdurgentmaximizershowfunctionmainskipyourifthisattrhref0texas at dallasurlclickfunction eventtakeclickfunctioneventpreventdefaultampdallascentervar url thisattrhrefurgent urgentminimizerhidehumanfind outut dallasuniversity of texasnewdocumentgetelementbyidbgvidcometurgenturl thisattrhrefout

Longtail Keyword Density for Utdallas.edu

KeywordsOccurences
skip to main6
university of texas4
texas at dallas4
urgent urgent-minimizerhide urgent3
urgent-minimizerhide urgent urgent-maximizershow3
var url thisattrhref3
url thisattrhref windowopenurl3
urgent phide3
urgent urgent-minimizerhide3
urgent-minimizerhide urgent3
urgent urgent-maximizershow3
ut dallas3
find out3
clickfunction event3
eventpreventdefault fbqtrack3
var url3
url thisattrhref3
thisattrhref windowopenurl3
urgent20
var17
utd11
amp8
students8
dallas7
main6
skip6
texas6
center5
if5
urgentongoing5
more5
clickfunction5
oct4
degrees4
find4
ut4
fbqtrack4
explore4
new4
university4
news4
03
phide3
thisattrhref3
url3
eventpreventdefault3
event3
documentgetelementbyidbgvid3
human3
international3
your3
expires3
why3
urgent-minimizerhide3
academic3
urgent-maximizershow3
take3
comet3
out3
function3
windowopenurl3

Utdallas.edu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Utdallas.edu is a scam?

Websites with Similar Names

Utdallas-tridelta.com
UT Dallas Tri Delta - Epsilon Theta
Utdallas.edu
The University of Texas at Dallas
Utdallas.t2hosted.com
The University Of Texas At Dallas - Parking Portal
Utdalphagam.com
???????????????????

Recently Updated Websites

Moneylogic.net 1 second ago.8020marketing.co.uk 1 second ago.Africanscreennetwork.com 2 seconds ago.Servicio-tecnico-castellon.net 3 seconds ago.Comfortpluscaregivers.org 3 seconds ago.Askforstaff.net 3 seconds ago.Wasser-mieten.com 3 seconds ago.Landerosfam.com 3 seconds ago.Alonsoadventure.com 4 seconds ago.Cochinet.com 5 seconds ago.Johnsfinn.net 7 seconds ago.Rebap.com.ph 8 seconds ago.Weddinglife.info 8 seconds ago.Hemploymentbureau.com 9 seconds ago.Timpayne.org 9 seconds ago.Riocumgirls.com 9 seconds ago.Unieuroclub.it 10 seconds ago.Pawswhiskersandclaws.com 10 seconds ago.Marpen.net 10 seconds ago.Kanemitsu.co.jp 11 seconds ago.Customgunmaker.com 11 seconds ago.Indiereaderhouston.com 12 seconds ago.Propowerrooterservice.com 13 seconds ago.Nblsc.us 13 seconds ago.Finansemble.fr 14 seconds ago.Bebehouse.com 15 seconds ago.Holaaugusta.com 15 seconds ago.Farm35.com 16 seconds ago.Bircavenuebath.com 17 seconds ago.Valentinalisitsa.com 17 seconds ago.