Forsíða - Útvarp Saga

Safety: Low trust score
Year Founded: 2003
Global Traffic Rank: 766,522
Estimated Worth: $9

Useful Searches

utvarpsaga

,

utvarpsaga ??ttir

,


Domain summary

Last updated
2021-03-23
Domain label
utvarpsaga
Domain extension
is
Domain registered:
2003-11-04
Domain updated:
2021-03-23
Domain expires:
2022-11-04
Global Traffic Rank
766,522
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Utvarpsaga.is registered?
A: Utvarpsaga.is was registered 17 years, 10 months, 2 weeks, 3 days, 20 hours, 24 minutes, 17 seconds ago on Tuesday, November 4, 2003.
Q: When was the WHOIS for Utvarpsaga.is last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 1 day, 20 hours, 24 minutes, 17 seconds ago on Tuesday, March 23, 2021.
Q: What are Utvarpsaga.is's nameservers?
A: DNS for Utvarpsaga.is is provided by the following nameservers:
  • ns0.dnsmadeeasy.com
  • ns1.dnsmadeeasy.com
  • ns2.dnsmadeeasy.com
  • ns3.dnsmadeeasy.com
Q: Who is the registrar for the Utvarpsaga.is domain?
A: The domain has been registered at ISNIC.
Q: What is the traffic rank for Utvarpsaga.is?
A: Utvarpsaga.is ranks 766,522 globally on Alexa. Utvarpsaga.is has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Utvarpsaga.is each day?
A: Utvarpsaga.is receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Utvarpsaga.is resolve to?
A: Utvarpsaga.is resolves to the IPv4 address 178.128.33.96.
Q: In what country are Utvarpsaga.is servers located in?
A: Utvarpsaga.is has servers located in the United Kingdom.
Q: What webserver software does Utvarpsaga.is use?
A: Utvarpsaga.is is powered by Nginx webserver.
Q: Who hosts Utvarpsaga.is?
A: Utvarpsaga.is is hosted by Forthnet in England, London, United Kingdom, Sl1.
Q: How much is Utvarpsaga.is worth?
A: Utvarpsaga.is has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Utvarpsaga.is Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Utvarpsaga.is Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Utvarpsaga.is

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

24 :
  1. Valmynd
  2. Héldu veffund um mikilvægi innviða, öryggi og ávinning samhliða fjölgun smáfarartækja
  3. NÝJUSTU FRÉTTIR
  4. Héldu veffund um mikilvægi innviða, öryggi og ávinning samhliða fjölgun smáfarartækja
  5. Undrandi á áhugaleysi borgarfulltrúa á atvinnumálum eldri borgara
  6. Úrskurðaður í gæsluvarðhald vegna frelsissviptingar og ítrekaðra brota gegn nálgunarbanni
  7. Opna Suðurstrandaveg með takmörkunum
  8. Þórdís Kolbrún undirritaði samevrópska ráðherrayfirlýsingu um nýsköpun og sprotafyrirtæki
  9. Trump stofnar eigin félagsmiðil á næstu mánuðum
  10. Kanadískur faðir handtekinn fyrir að ræða kynskipti dóttur sinnar í trássi við dómsúrskurð – er bannað að segja „hún”
  11. Sænska útvarpið verðlaunar fangelsaðan meðlim glæpaklíku sem „hljómlistamann ársins”
  12. „Lamaður og hjólastólbundinn” nauðgari fullfrískur á lúxusferðalögum í Miðausturlöndum
  13. Einar Brynjólfsson efstur í prófkjöri Pírata í Norðausturkjördæmi
  14. Telja litla hættu stafa af gosinu – Fylgjast með mögulegri gasmengun
  15. Hrumur forseti hafnar boði Pútíns um umræður í beinni á netinu
  16. Eldgos hafið á Reykjanesi
  17. Aðgerðir yfirvalda gegn Covid komnar út í öfgar
  18. Joe Biden er sjúkur maður, kemst varla sjálfur lengur um borð í Air Force One – fellur í tröppunum og litlu munar að hann rúlli niður
  19. Viltu styðja Útvarp Sögu?
  20. SKOÐANAKÖNNUN
  21. Nýlegar fréttir
  22. ELDRI FRÉTTIR
  23. ELDRI FRÉTTIR
  24. ELDRI FRÉTTIR

H4 Headings

66 :
  1. Undrandi á áhugaleysi borgarfulltrúa á atvinnumálum eldri borgara
  2. Úrskurðaður í gæsluvarðhald vegna frelsissviptingar og ítrekaðra brota gegn nálgunarbanni
  3. Opna Suðurstrandaveg með takmörkunum
  4. Þórdís Kolbrún undirritaði samevrópska ráðherrayfirlýsingu um nýsköpun og sprotafyrirtæki
  5. Trump stofnar eigin félagsmiðil á næstu mánuðum
  6. Hvert af eftirtöldum bóluefnum teystir þú best?
  7. Héldu veffund um mikilvægi innviða, öryggi og ávinning samhliða fjölgun smáfarartækja
  8. Undrandi á áhugaleysi borgarfulltrúa á atvinnumálum eldri borgara
  9. Úrskurðaður í gæsluvarðhald vegna frelsissviptingar og ítrekaðra brota gegn nálgunarbanni
  10. Opna Suðurstrandaveg með takmörkunum
  11. Þórdís Kolbrún undirritaði samevrópska ráðherrayfirlýsingu um nýsköpun og sprotafyrirtæki
  12. Trump stofnar eigin félagsmiðil á næstu mánuðum
  13. Kanadískur faðir handtekinn fyrir að ræða kynskipti dóttur sinnar í trássi við dómsúrskurð – er bannað að segja „hún”
  14. Sænska útvarpið verðlaunar fangelsaðan meðlim glæpaklíku sem „hljómlistamann ársins”
  15. „Lamaður og hjólastólbundinn” nauðgari fullfrískur á lúxusferðalögum í Miðausturlöndum
  16. Einar Brynjólfsson efstur í prófkjöri Pírata í Norðausturkjördæmi
  17. Telja litla hættu stafa af gosinu – Fylgjast með mögulegri gasmengun
  18. Hrumur forseti hafnar boði Pútíns um umræður í beinni á netinu
  19. Eldgos hafið á Reykjanesi
  20. Aðgerðir yfirvalda gegn Covid komnar út í öfgar
  21. Joe Biden er sjúkur maður, kemst varla sjálfur lengur um borð í Air Force One – fellur í tröppunum og litlu munar að hann rúlli niður
  22. Héldu veffund um mikilvægi innviða, öryggi og ávinning samhliða fjölgun smáfarartækja
  23. Undrandi á áhugaleysi borgarfulltrúa á atvinnumálum eldri borgara
  24. Úrskurðaður í gæsluvarðhald vegna frelsissviptingar og ítrekaðra brota gegn nálgunarbanni
  25. Opna Suðurstrandaveg með takmörkunum
  26. Þórdís Kolbrún undirritaði samevrópska ráðherrayfirlýsingu um nýsköpun og sprotafyrirtæki
  27. Trump stofnar eigin félagsmiðil á næstu mánuðum
  28. Kanadískur faðir handtekinn fyrir að ræða kynskipti dóttur sinnar í trássi við dómsúrskurð – er bannað að segja „hún”
  29. Sænska útvarpið verðlaunar fangelsaðan meðlim glæpaklíku sem „hljómlistamann ársins”
  30. „Lamaður og hjólastólbundinn” nauðgari fullfrískur á lúxusferðalögum í Miðausturlöndum
  31. Einar Brynjólfsson efstur í prófkjöri Pírata í Norðausturkjördæmi
  32. Telja litla hættu stafa af gosinu – Fylgjast með mögulegri gasmengun
  33. Hrumur forseti hafnar boði Pútíns um umræður í beinni á netinu
  34. Eldgos hafið á Reykjanesi
  35. Aðgerðir yfirvalda gegn Covid komnar út í öfgar
  36. Joe Biden er sjúkur maður, kemst varla sjálfur lengur um borð í Air Force One – fellur í tröppunum og litlu munar að hann rúlli niður
  37. Kona á sjötugsaldri deyr eftir að hafa fengið bóluefni Astra Zeneca
  38. Ný regla í Danmörku: Hámark 30% íbúa af „ekki vestrænum uppruna” í hverju íbúðarhverfi
  39. Mótmæli skipulögð í 40 löndum á laugardaginn gegn takmörkum mannréttinda í nafni covid
  40. Segir Gunnar Braga ekki hafa haft umboð til að stöðva ESB ferlið – Bankahrunið hefði ekki orðið ef Ísland hefði verið í Evrópusambandinu
  41. Ummæli Joe Biden um Pútín einsdæmi – Nýtt kalt stríð?
  42. Svar Pútíns við morðingjasýn Bidens: „Hann hefur horft í spegilinn”
  43. Staðfest í Noregi að bóluefni AstraZeneca veldur blóðtappa
  44. 75% Bandaríkjamanna styðja að krafa um persónuskilríki við kosningar verði að lögum
  45. Demókratar vilja leiða kosningasvindlið í lög – ætla að flytja kosningalögsögu allra ríkja til Washington til að ráða kosningum í framtíðinni
  46. Flokkur fólksins gagnrýnir harðlega tilslakanir á landamærum – Erum að bjóða hér fjórðu bylgju velkomna
  47. Vill að skipuð verði rannsóknarnefnd til þess að rannsaka stórútgerðir
  48. Rúmlega 350 milljónir kr. í menningartengda tekjufallsstyrki
  49. Kortleggja fjölda þeirra sem eru heimilislausir og aðstæður þeirra
  50. Boða breytingar á sóttvarnaráðstöfunum
  51. David Asher fv. rannsóknarlögreglustjóri í Bandaríkjunum segir rannsóknarstofuna í Wuhan vinna með lífefnavopn
  52. Hernaðarstefna Joe Biden gegn Sýrlandi komin á fullt skrið – Evrópusambandið styður við aðgerðirnar með viðskiptahindrunum
  53. Danmörk bannar „andlýðræðislegar peningagjafir” frá útlöndum
  54. Varað við grjóthruni í fjöllum og sprungum á vegum á Reykjanesi
  55. Svíar stöðva bólusetningu með Astra Zeneca
  56. Græn stefna Samfylkingarinnar sögð marka tímamót
  57. Telur ríkisstjórnina standa styrkum fótum – Líklegt að stjórnarsamstarfið haldi áfram
  58. Norskur heilbrigðsstarfsmaður, fullfrísk kona, dó eftir bólusetningu með AstraZeneca bóluefni
  59. Kínverjar og Rússar í samstarfi um nýju Polar silkileiðina – Utanríkisráðherra Íslands styður stefnu Kínverja
  60. Kínverskt þvottaefni fyrir rasista – breytir blökkufólki í Kínverja
  61. Ný, smitsamari og skaðlegri veira „í rannsókn” hjá Veirustofnuninni í Wuhan
  62. „Það er komið nóg!” – Lokunum mótmælt í Þýskalandi og Hollandi
  63. Vinsældir Harry og Meghan hrapa eftir viðtalið hjá Oprah Winfrey
  64. Lagið Voices með Tússa valið framlag Svía til Eurovision í ár
  65. Bjargaði Íslendingum að ganga út frá fiskveiðisamningum við ESB – „Við afhendum ekki fiskveiðilögsöguna!”
  66. Biden stöðvar útflutning á bóluefni til annarra landa – „Bandaríkjamenn fá bóluefnið fyrst, svo hjálpum við öðrum”

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

88 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-77296058-1

Links - Internal

148:

Links - Internal (nofollow)

0:

Links - Outbound

2:

Links - Outbound (nofollow)

0:

Keyword Cloud for Utvarpsaga.is

ekkitakmrkunum22 mars 2021rdsrllisjkurforce onemaur kemstnskpun og sprotafyrirtki22one fellur trppunumer sjkur maursamhlia fjlgunfyrirog trekara brotamnuum22 marsefstur prfkjri8211 fylgjastum bor airhellip20hellip22 marshafiktsinnar trssi viborgara23og sprotafyrirtki22 marsfellur trppunum ogsprotafyrirtki22og vinning samhliahttu stafa afum nskpun ogbidensinnarbrota gegnsamevrpska rherrayfirlsingu umsuurstrandaveg me takmrkunum22ra2021 eldri frttirsuurstrandavegnew datefylgjast me mgulegrihellip22 mars 2021frttirmars 2021rds2021rskuraur gsluvarhald vegnatvarpi verlaunar fangelsaansemog litluprfkjrioptionssjlfurtypetvarpi verlaunarstafa af gosinu8211 fylgjast memelim glpaklku semvarlabor air forcevinning samhlia fjlgunfylgjasthldu veffundmars 2021opnastyrktarreikningur tvarpshellip23 marsmunar a hannrherrayfirlsinguum mikilvginlgunarbanni22 marstrssibluefnihljmlistamannreturnone fellur2021frttirtrppunum ogstofnar eigin2021erlentfjlgunundirritai samevrpskascrolldistance timinghafafangelsaan melimstofnar2021rskuraur gsluvarhaldhjlastlbundinn8221yfirvalda gegnboinowrherrayfirlsingu um nskpunforcelxusferalgumgosinu 82114covid komnarnaugari fullfrskur lxusferalgumdategsluvarhald3force one fellurefstur prfkjri pratabrotaogra kynskipti dtturstafa afhjlastlbundinn8221 naugari fullfrskurfair handtekinnvegnagosinutiminglitla httuveffund umsamevrpskahugaleysi borgarfulltrawindowyfirvaldakomnarinnvia ryggihandtekinnundefinedhldusem hljmlistamannverlaunar fangelsaaner sjkurfullfrskur lxusferalgumnstu mnuum22 marsbrynjlfsson efstur prfkjrihafnareldri frttirblusetningutvarpsfair handtekinn fyrirhafnar boigegnkolbrn undirritai samevrpskakomnar tog vinningstofnar eigin flagsmiilverlaunar fangelsaan melim2021trumpborgara23 marsbanna a segjabiden ereigin flagsmiil nstuum umruratvinnumlumnaugari fullfrskurme takmrkunum22fullfrskursuurstrandaveg me2021trump stofnar eiginssprotafyrirtki22 mars 2021trumpcachevinning samhliame mgulegri2021rds kolbrn undirritaihellip20 marsnlgunarbanni22fjslengur um borgegn nlgunarbanni22marsmars 2021trumpryggikemstglpaklkuafbrynjlfssonefstureventnameborgarfulltra atvinnumlumverifellur trppunum2021rds kolbrnscrolldistancemars 2021rskuraurtrekara brota gegnog hjlastlbundinn8221 naugarierhellip22hellip19 marsborboi ptns umveffundkolbrn undirritaioneum nskpuntrppunum og litlulabelkynskipti2flagsmiil nstuum mikilvgi innviaog trekaradttur sinnar trssiparseintdocheightmars 2021rds kolbrngosinu 8211 fylgjastkemst varlamars 2021erlenthann rllisgu2021opna suurstrandaveg mevarla sjlfurumboi ptnseldri borgara23hellip21pratahellip19newaf gosinu 8211fangelsaan melim glpaklku2021 eldriforseti hafnarptns um umrurmelim glpaklkueldriair forceundirritaimikilvgi innvia ryggiifargsdmsrskur er bannalitlatvarps sgutvarpinskpungegn nlgunarbanni22 marssamevrpska rherrayfirlsinguhttudmsrskur er2021opnafellurscrollmaur kemst varlatakmrkunum22 mars1elemscovid komnar tptnsdocumentfylgjast metrueair force onetrssi vi dmsrskurfunctionra kynskiptier banna2021opna suurstrandaveg2021rdsfrelsissviptingar og trekarakt 6402140310mars 2021 eldrieldri borgara23 marslenguratvinnumlum eldri borgara23vargegn coviddepthkynskipti dttursegjamikilvgi innviatakmrkunum22gegn covid komnarhandtekinn fyrirsjlfur lengurtrekarahellip21 mars 2021erlentforseti hafnar boinaugarinstunstu mnuum22beinnifangelsaanlengur umeftirumrur beinnitrekara brotaaf gosinufrelsissviptingarhellip23 mars 2021frttirmaurryggi ogmunarmars 2021hjlastlbundinn8221 naugaristyrktarreikningurairveffund um mikilvgikynskipti dttur sinnarpreviousfrfrelsissviptingar ogrherrayfirlsingu umdttur sinnarumrur5v0brynjlfsson efsturkolbrnverlaunarvi dmsrskur erundirritai samevrpska rherrayfirlsingucovidscroll depthlitlu munarhellip21 marsprfkjri prataatvinnumlum eldrieventbannahttu stafayfirvalda gegn covidfieldsarraylitla httu stafamars 2021trump stofnarsjkur maur kemstborgara23 mars 2021rskuraurptns umnlgunarbanni22 mars 2021opna64021403102021rskuraurstafasamhliainnvia ryggi ogog hjlastlbundinn8221mars 2021frttirfairtrssi vimars 2021rskuraur gsluvarhaldtrppunumog sprotafyrirtki22hugaleysi borgarfulltra atvinnumlumborgarfulltramebrota gegn nlgunarbanni22flagsmiil nstu mnuum22borgarfulltra atvinnumlum eldrigsluvarhald vegna frelsissviptingartilhanninnviamikilvgilitluum borexactmetricsobjectsendeventmelimtdmsrskurflagsmiilbor airum umrur beinniog litlu munarglpaklku semme takmrkunum22 marsvarla sjlfur lengurfyrir a raeigin flagsmiiltypeofryggi og vinningjshldu veffund ummgulegrivinningvidttursprotafyrirtki22 marshellip232021trump stofnareiginvegna frelsissviptingar ogforsetiidglpaklku sem hljmlistamannnskpun ogsjlfur lengur umbindscrolldepthmars 2021opna suurstrandaveggsluvarhald vegnavegna frelsissviptingarhugaleysisinnar trssistyrktarreikningur tvarps sguhafnar boi ptnsmnuum22frttirsjkur maurvi dmsrskurtvarpkemst varla sjlfurbiden er sjkur

Longtail Keyword Density for Utvarpsaga.is

KeywordsOccurences
veffund um mikilvgi5
og trekara brota5
stofnar eigin flagsmiil5
um nskpun og5
rherrayfirlsingu um nskpun5
samevrpska rherrayfirlsingu um5
undirritai samevrpska rherrayfirlsingu5
kolbrn undirritai samevrpska5
trekara brota gegn5
frelsissviptingar og trekara5
um mikilvgi innvia5
vegna frelsissviptingar og5
gsluvarhald vegna frelsissviptingar5
borgarfulltra atvinnumlum eldri5
hugaleysi borgarfulltra atvinnumlum5
og vinning samhlia5
ryggi og vinning5
innvia ryggi og5
mikilvgi innvia ryggi5
eigin flagsmiil nstu5
hldu veffund um4
vinning samhlia fjlgun4
8211 fylgjast me3
yfirvalda gegn covid3
um umrur beinni3
ptns um umrur3
boi ptns um3
hafnar boi ptns3
forseti hafnar boi3
fylgjast me mgulegri3
covid komnar t3
naugari fullfrskur lxusferalgum3
gosinu 8211 fylgjast3
af gosinu 82113
stafa af gosinu3
httu stafa af3
litla httu stafa3
efstur prfkjri prata3
brynjlfsson efstur prfkjri3
gegn covid komnar3
air force one3
biden er sjkur3
force one fellur3
mars 2021 eldri3
styrktarreikningur tvarps sgu3
munar a hann3
og litlu munar3
trppunum og litlu3
fellur trppunum og3
one fellur trppunum3
og hjlastlbundinn8221 naugari3
er sjkur maur3
bor air force3
um bor air3
lengur um bor3
sjlfur lengur um3
varla sjlfur lengur3
kemst varla sjlfur3
maur kemst varla3
sjkur maur kemst3
hjlastlbundinn8221 naugari fullfrskur3
sinnar trssi vi3
glpaklku sem hljmlistamann3
nlgunarbanni22 mars 2021opna3
2021rds kolbrn undirritai3
mars 2021rds kolbrn3
takmrkunum22 mars 2021rds3
me takmrkunum22 mars3
suurstrandaveg me takmrkunum223
2021opna suurstrandaveg me3
mars 2021opna suurstrandaveg3
gegn nlgunarbanni22 mars3
og sprotafyrirtki22 mars3
brota gegn nlgunarbanni223
2021rskuraur gsluvarhald vegna3
mars 2021rskuraur gsluvarhald3
borgara23 mars 2021rskuraur3
eldri borgara23 mars3
atvinnumlum eldri borgara233
hellip23 mars 2021frttir3
nskpun og sprotafyrirtki223
sprotafyrirtki22 mars 2021trump3
melim glpaklku sem3
trssi vi dmsrskur3
fangelsaan melim glpaklku3
verlaunar fangelsaan melim3
tvarpi verlaunar fangelsaan3
hellip21 mars 2021erlent3
banna a segja3
dmsrskur er banna3
vi dmsrskur er3
dttur sinnar trssi3
mars 2021trump stofnar3
kynskipti dttur sinnar3
ra kynskipti dttur3
fyrir a ra3
fair handtekinn fyrir3
hellip22 mars 2021frttir3
nstu mnuum22 mars3
flagsmiil nstu mnuum223
2021trump stofnar eigin3
2021 eldri frttir3
mars 2021frttir10
mars 2021erlent6
stofnar eigin6
um mikilvgi5
mars 20215
flagsmiil nstu5
eigin flagsmiil5
nskpun og5
um nskpun5
rherrayfirlsingu um5
samevrpska rherrayfirlsingu5
undirritai samevrpska5
kolbrn undirritai5
suurstrandaveg me5
veffund um5
trekara brota5
og trekara5
frelsissviptingar og5
vegna frelsissviptingar5
gsluvarhald vegna5
atvinnumlum eldri5
borgarfulltra atvinnumlum5
hugaleysi borgarfulltra5
vinning samhlia5
og vinning5
ryggi og5
innvia ryggi5
mikilvgi innvia5
brota gegn5
hellip22 mars4
hldu veffund4
samhlia fjlgun4
scroll depth4
gosinu 82113
yfirvalda gegn3
sjkur maur3
af gosinu3
biden er3
komnar t3
covid komnar3
gegn covid3
hellip19 mars3
8211 fylgjast3
umrur beinni3
um umrur3
ptns um3
boi ptns3
hafnar boi3
forseti hafnar3
me mgulegri3
fylgjast me3
er sjkur3
litlu munar3
maur kemst3
og litlu3
new date3
eldri frttir3
2021 eldri3
kt 640214-03103
tvarps sgu3
styrktarreikningur tvarps3
hann rlli3
httu stafa3
trppunum og3
kemst varla3
fellur trppunum3
one fellur3
force one3
air force3
bor air3
um bor3
lengur um3
sjlfur lengur3
varla sjlfur3
stafa af3
er banna3
litla httu3
takmrkunum22 mars3
mnuum22 mars3
nstu mnuum223
2021trump stofnar3
mars 2021trump3
sprotafyrirtki22 mars3
og sprotafyrirtki223
2021rds kolbrn3
mars 2021rds3
me takmrkunum223
handtekinn fyrir3
2021opna suurstrandaveg3
mars 2021opna3
nlgunarbanni22 mars3
gegn nlgunarbanni223
2021rskuraur gsluvarhald3
mars 2021rskuraur3
borgara23 mars3
eldri borgara233
hellip23 mars3
fair handtekinn3
ra kynskipti3
hellip20 mars3
glpaklku sem3
prfkjri prata3
efstur prfkjri3
brynjlfsson efstur3
fullfrskur lxusferalgum3
naugari fullfrskur3
hjlastlbundinn8221 naugari3
og hjlastlbundinn82213
sem hljmlistamann3
melim glpaklku3
kynskipti dttur3
fangelsaan melim3
verlaunar fangelsaan3
tvarpi verlaunar3
hellip21 mars3
dmsrskur er3
vi dmsrskur3
trssi vi3
sinnar trssi3
dttur sinnar3
scrolldistance timing3
mars81
og33
var20
um20
if15
me14
function12
gegn11
2021frttir10
vi10
09
undefined8
return8
eldri8
til7
er7
kolbrn7
frttir7
16
biden6
scroll6
vegna6
2021erlent6
stofnar6
eigin6
ekki6
trekara5
ryggi5
af5
innvia5
brynjlfsson5
hann5
vinning5
mikilvgi5
veffund5
ra5
brota5
nstu5
samhlia5
atvinnumlum5
frelsissviptingar5
suurstrandaveg5
gsluvarhald5
undirritai5
samevrpska5
rherrayfirlsingu5
nskpun5
flagsmiil5
sem5
borgarfulltra5
hugaleysi5
previous5
t4
fr4
ptns4
js4
id4
fjs4
bluefni4
depth4
cache4
sgu4
eventname4
typeof4
event4
24
hellip224
fieldsarray4
fjlgun4
fyrir4
type4
hldu4
timing4
beinni4
scrolldistance4
rlli3
tvarp3
args3
elems3
styrktarreikningur3
label3
trppunum3
munar3
litlu3
kt3
fellur3
one3
force3
air3
tvarps3
eftir3
640214-03103
lengur3
date3
new3
33
window3
true3
document3
exactmetricsobjectsendevent3
bindscrolldepth3
s3
parseintdocheight3
veri3
43
options3
53
blusetningu3
bor3
hellip203
sjlfur3
kynskipti3
fangelsaan3
verlaunar3
tvarpi3
hellip213
v3
segja3
banna3
dmsrskur3
trssi3
sinnar3
dttur3
handtekinn3
glpaklku3
fair3
mnuum223
2021trump3
sprotafyrirtki223
2021rds3
takmrkunum223
2021opna3
nlgunarbanni223
2021rskuraur3
borgara233
hellip233
melim3
hljmlistamann3
varla3
forseti3
kemst3
maur3
sjkur3
komnar3
covid3
yfirvalda3
hellip193
hafi3
umrur3
boi3
hafnar3
mgulegri3
hjlastlbundinn82213
fylgjast3
gosinu3
stafa3
httu3
litla3
hafa3
prata3
prfkjri3
efstur3
lxusferalgum3
fullfrskur3
naugari3
now3

Who hosts Utvarpsaga.is?

Utvarpsaga.is Hosting Provider Information

Hosted IP Address:178.128.33.96
Hosted Hostname:276809.cloudwaysapps.com
Service Provider:Forthnet
Hosted Country:United KingdomGB
Location Latitude:51.5353
Location Longitude:-0.6658
Webserver Software:nginx

Is "Forthnet" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Forthnet
0.0136%

HTTP Header Analysis for Utvarpsaga.is

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 23 Mar 2021 22:24:00 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 23596
Connection: keep-alive
Link:; rel="https://api.w.org/", ; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip
Access-Control-Allow-Origin: *

Utvarpsaga.is Domain Nameserver Information

HostIP AddressCountry
ns0.dnsmadeeasy.com 208.94.148.2
ns1.dnsmadeeasy.com 208.80.124.2
ns2.dnsmadeeasy.com 208.80.126.2
ns3.dnsmadeeasy.com 208.80.125.2


Need to find out who hosts Utvarpsaga.is?


Domain Registration (WhoIs) information for Utvarpsaga.is

 % This is the ISNIC Whois server.
%
% Rights restricted by copyright.
% See https://www.isnic.is/en/about/copyright

domain: utvarpsaga.is
registrant: AK251-IS
admin-c: SE2436-IS
tech-c: SE2436-IS
zone-c: TL65-IS
billing-c: SE2436-IS
nserver: ns0.dnsmadeeasy.com
nserver: ns1.dnsmadeeasy.com
nserver: ns2.dnsmadeeasy.com
nserver: ns3.dnsmadeeasy.com
dnssec: unsigned delegation
created: November 4 2003
expires: November 4 2022
source: ISNIC

nic-hdl: AK251-IS
address: IS
created: February 20 2014
source: ISNIC

role: SagaNet - Utvarp Saga ehf.
nic-hdl: SE2436-IS
address: Thverholti 14
address: IS-105 Reykjavik
e-mail: Login to show email
August 12 2014
source: ISNIC

role: Tiggee LLC
nic-hdl: TL65-IS
address: 11490 Commerce Park Drive, Suite 140
address: Reston, Virginia 20191
address: US
e-mail: Login to show email
August 31 2011
source: ISNIC

Websites with Similar Names

Utvar-lutsk.com
???? ????????
Utvaradio.com
Radio Universidad Teológica Vida Abundante| Clasificados Vida Abundante
Utvarpsaga.is
Forsíða - Útvarp Saga

Recently Updated Websites

Mountainperformanceengineering.net (2 seconds ago.)Chicomexico.com (3 seconds ago.)Thequincysun.com (5 seconds ago.)Rd519.com (6 seconds ago.)Paperangleboard.com (8 seconds ago.)28098333.com (8 seconds ago.)Vikas.edu.my (9 seconds ago.)Jhxip.com (11 seconds ago.)Trimbleforestryautomation.com (12 seconds ago.)Gaisler.com (12 seconds ago.)Vasington.org (13 seconds ago.)Hashextractoil.com (15 seconds ago.)Blocktechit.com (16 seconds ago.)Pharaon-cazino.rocks (16 seconds ago.)Ordersuperduper.com (17 seconds ago.)Pussynextdoor.com (17 seconds ago.)Pinjamanbest2u.com (17 seconds ago.)Play-poker-online-s.com (18 seconds ago.)Ampbanking.com.au (20 seconds ago.)Svgcutouts.com (21 seconds ago.)Undervalued.realty (23 seconds ago.)Kimikomoore.com (23 seconds ago.)Operlis.biz (24 seconds ago.)52kshu.com (24 seconds ago.)Writers-free-reference.com (26 seconds ago.)Qy1565.com (27 seconds ago.)Omundsenconstructioncorp.com (27 seconds ago.)Monsieurjardin.com (28 seconds ago.)Cookblah.com (30 seconds ago.)Cafe-future.ru (30 seconds ago.)

Recently Searched Keywords

overflow (3 seconds ago.)-80%ends in 2d : 0h : 9m (6 seconds ago.)expresiones (9 seconds ago.)hip hop 2020 mix (10 seconds ago.)mydogan (10 seconds ago.)global industrial (10 seconds ago.)sc oberlsbach (10 seconds ago.)amy deluxe (12 seconds ago.)2021 technology ipos (13 seconds ago.)gallerylist6753 pho-isotopeitem flex-basiscalc100 (14 seconds ago.)active duty aircraft carriers (15 seconds ago.)15px --line-bg-image (15 seconds ago.)mengurus wang (15 seconds ago.)2021 technology news (16 seconds ago.)2021 technology predictions (17 seconds ago.)buy domain on dan (18 seconds ago.)2021 technology gadgets (18 seconds ago.)2000 sale price (18 seconds ago.)herba (19 seconds ago.)2021 technology inventions (19 seconds ago.)wszystkie numery (20 seconds ago.)donde poner el papel higiénico en el baño (21 seconds ago.)premiere auf (22 seconds ago.)mind break (23 seconds ago.)mcdfoodforthoughts (25 seconds ago.)normal 14px14em spinnakersans-serif--alpha-txt21--brwh3px--bghvar--color16--brdhvar--color16--brwf3px--bgfvar--color16--brdfvar--color16--brwe1px--bgevar--color16--brde13900--txtlblvar--color13--trnsopacity (25 seconds ago.)federwiege fr babysmetakeywordsseopagetitleseolullababy (25 seconds ago.)colors tamil (25 seconds ago.)heroínas dentro y fuera de pantalla: estrellas de hollywood que se sobrepusieron a un dolor profundo (25 seconds ago.)bible almanac (27 seconds ago.)