UZER | Application mobile Villes d'aide au tri

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

La solution de référence destinée aux collectivités locales pour accompagner leurs usagers dans la gestion de leurs déchets.



Domain summary

Last updated
2021-04-06
Domain label
uzer
Domain extension
eu
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Uzer.eu registered?
A: Uzer.eu was registered 5 months, 2 weeks, 6 days, 6 hours, 33 minutes, 12 seconds ago on Tuesday, April 6, 2021.
Q: When was the WHOIS for Uzer.eu last updated?
A: The WHOIS entry was last updated 5 months, 2 weeks, 6 days, 6 hours, 33 minutes, 12 seconds ago on Tuesday, April 6, 2021.
Q: What are Uzer.eu's nameservers?
A: DNS for Uzer.eu is provided by the following nameservers:
  • ns2.nom-domaine.fr
  • ns1.nom-domaine.fr
Q: Who is the registrar for the Uzer.eu domain?
A: The domain has been registered at EURID.
Q: What is the traffic rank for Uzer.eu?
A: Uzer.eu has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Uzer.eu each day?
A: Uzer.eu receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Uzer.eu resolve to?
A: Uzer.eu resolves to the IPv4 address 23.236.62.147.
Q: In what country are Uzer.eu servers located in?
A: Uzer.eu has servers located in the United States.
Q: What webserver software does Uzer.eu use?
A: Uzer.eu is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Uzer.eu?
A: Uzer.eu is hosted by GOOGLE in Iowa, Council Bluffs, United States, 51502.
Q: How much is Uzer.eu worth?
A: Uzer.eu has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Uzer.eu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Uzer.eu Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Uzer.eu

H1 Headings

1 :
  1. Tous vos services déchets réunis dans une application

H2 Headings

8 :
  1. Offrez un service sur mesure à vos usagers
  2. Réduisez les erreurs de tri
  3. Optimisez la collecte hors foyer
  4. Facilitez la gestion quotidienne des déchets
  5. Collaborez avec vos usagers
  6. Sensibilisez TOUS vos usagers !
  7. Gérez simplement et en toute autonomie votre application
  8. Intéressé(e) par nos solutions ?

H3 Headings

1 :
  1. Découvrez le boitier connecté Montri

H4 Headings

4 :
  1. Performance
  2. Simplicité
  3. Accessibilité
  4. Proximité

H5 Headings

0 :

H6 Headings

21 :
  1. Solutions
  2. A propos
  3. Contact
  4. Application Montri
  5. Boitier Montri
  6. Scan de produits
  7. Références
  8. Recrutement
  9. L'API UZER
  10. Tarifs
  11. Presse
  12. Collectivités
  13. Marques
  14. Qui sommes-nous ?
  15. Powered by UZER S.A.S
  16. L'application Montri
  17. L'application web
  18. Montri
  19. Le Back-office
  20. Montri
  21. Vos avantages

Total IFRAMEs

1 :

Total Images

18 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

6:

Links - Outbound (nofollow)

0:

Keyword Cloud for Uzer.eu

204 204marginleft calc10046 46positionabsolutetop0right0bottom0left0transitionbordercolorstylek74nknjfnavcontainercollectivitstxtnew ulstylek8jvju0flabelwrapperstylekbrn4j1hlanguagebuttonspacergestion de leursrfrencepositionabsolutetop0right0bottom0left0transitionbordercolor 04s easestylek0qpe55lbgstylekbrn4j1hlanguagebuttoniconstylekbrn4j1hlanguagebuttonhasiconusagers dansdestine auxrgba244 112txtnewpositionstaticboxshadow000villes daidepathol ulborderwidth2px borderstylesolidbordercolorrgba249daide05positionabsolutetop0right0bottom0left0transitionbordercolor 04sbackgroundcolor 04s easestylek8jvijqglabel249 249localesjustifycontentcenterjustifycontentflexendstylekbrn4j1hlanguagebuttoniconstylekbrn4j1hlanguagebuttonhasicon margin0normal normal normalpositionstaticboxshadow000 0font normalvos points1bordersolid rgba24446 46 1borderradius20pxmargin0 14px 0colorf47000ease 0s backgroundcolorstylek74nknjfrepeaterbuttonlabelstylek74nknjfnavcontainerleftdirection0px 0px 0positionrelativewhitespacenowrap249 1backgroundcolorrgba255n n nninfosvgtypeshapeviewbox0dansaccompagnerwebcalc100 980px10px 10px 10pxstylekbrn4j1hlanguagebuttoncenterstylekbrn4j1hdropdownwrapperbackgroundcolorrgba204 204 2045px 5px0pxcursorpointerselecthoverstylekbrn4j1hhorizontalvilles daide autransformease 0scolorffffffpadding0backgroundcolorrgba255 255strc1dataresponsivemontrihidetitletrueicondescriptionseolaselectdatapreviewerrorstylek8jvijqglinktri980px 05leursstylek9u4yvc2linknormal 18px14em620pxjustifycontentflexstartstylek74nknjfnavcontainerarrowstylek74nknjfnavcontainercenterdirectionsolution0 0varlefontnormal normal normalcalc10014px 04px stylekbrn4j1hlanguagebuttoncenterstylekbrn4j1hdropdown stylekbrn4j1hdropdownwrapperimportantstrc1inlinecontentusagersbackgroundcolor 04sau97 216px14em16px14em avenirltw0185heavy1475544sansserif11255 255stylekbrn4j1hlanguagebuttoniconfillf47000positionfixedleurs dchetsmetakeywordsseopagetitleseouzer applicationtransitioncolor 04sbackgroundcolorrgba244 112stylek74nknjfnavcontainerarrow stylek74nknjfnavcontainersvgcontainerultxtnewdisponiblemarginleftsvgifborderradius20px positionabsolutetop0right0bottom0left0transitionbordercolorborderwidth2pxdchetstypetitlechildrenuzer application mobile8normal normal 16px14emdchetsmetakeywordsseopagetitleseouzer application112 0 11 stylek74nknjfnavcontainernormal normal 20px14emrgba244 112 0stylekbrn4j1hlanguagebuttonlastchild1villesselectborderstylesolidbordercolorrgba249 249suroldirrtllocales pour accompagnerffffffselectfocuslapplication montrinormal 20px14emavenirltw0185heavy1475544sansserif transitioncolor 04snotre1backgroundcolorrgba2551backgroundcolorrgba255 255des usagerscalc10pxfontbackgroundcolorrgba244des0 1 0pxcursorpointertransitioncolor 04s easedchetstypetitlechildrenuzer0 20020px14emnormal 16px14embackgroundcolorrgba255 255 255stylek74nknjfnavcontainerarrowstylek74nknjfnavcontainerrightdirectionfontnormalstylekbrn4j1hlanguagebuttonlabelstylekbrn4j1hlanguagebuttonhastext margin0stylek75xjst4linkmargin0 14pximportantleftauto importantzindex50easesolidcolor000000borderstylesolidbordercolorrgba249tripageuriseoapplicationmontrihidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidhuz0hdesktopbgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidhuz0hmobilebgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemkbrnkq4fmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsetitleurif77bf5a020a60c61ad4fce8023da9007d60f8bmv2pngwidth500height500altadvancedseodatatagstypemetapropsnamedescriptioncontentlaauxmargin0lineheightnormalletterspacingnormal txtnewleurs usagers dansstylek74nknjfnavcontainerarrowaux collectivits locales0002destine aux collectivitsstylekbrn4j1hlanguagebuttonrightstylek9u4yvc2labelnormalvos04s easetopautobottom0serviceslocales pourcollectivits locales pour0leurs dchetsmetakeywordsseopagetitleseouzerstylekbrn4j1hlanguagebuttoncalc100 980px 0510pxaccompagner leurs usagersstylekbrn4j1hlanguagebuttonarrowiconau tripageuriseoapplicationmontrihidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidhuz0hdesktopbgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidhuz0hmobilebgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemkbrnkq4fmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsetitleurif77bf5a020a60c61ad4fce8023da9007d60f8bmv2pngwidth500height500altadvancedseodatatagstypemetapropsnamedescriptioncontentla solutionpour accompagner leurs0px 0pxtextaligninitialdisplayflexalignitemscentergestionstylek8jvju0flabel1bordersolid rgba244 112unestylek8jvijqglabelwrapper0pxcursorpointer importantapplication mobilebackgroundcolorrgba244 112 0fontnormal normalbackgroundcolorrgba204 204leurs dchetstypetitlechildrenuzerselectdatapreviewerror stylek74nknjfnavcontainerarrowmarginleft calc100 980px0pxstylek74nknjfnavcontainercenterdirection0px calc10px46 1 0px1 0pxcursorpointer4pxul50 50normal normal1px5pxstylek8jvju0flinkstylekbrn4j1hlanguagebuttoncenterstylekbrn4j1hlanguagebuttonhorizontal1 0pxsolution de rfrenceolrfrence destineselectdataerrortrueetavenirltw0185heavy1475544sansserif transitioncolor14px0px calc10px 0pxcolor ffffffmargin0stylek75xjst4labeln nborderwidth2px borderstylesolidbordercolorrgba249 249borderradius20px positionabsolutetop0right0bottom0left0transitionbordercolor 04slb1itemscontainer100widthapplication mobile villes46 1dchetsmetakeywordsseopagetitleseouzer application mobileleurs dchetstypetitlechildrenuzer applicationstylekbrn4j1hlanguagebuttonlabelstylekbrn4j1hlanguagebuttonhastextavecimportantzindex500 1backgroundcolor980pxrfrence destine auxmobile villes daidepour accompagnerapplicationmargin0lineheightnormalletterspacingnormalborderstylesolidbordercolorrgba249 249 249nninfosvgtypeshapeviewbox0 0positionstaticboxshadow000 0 0204 204 1bordersolidcollectestylekhepvb8sstylek74nknjfnavcontainerrightdirectionstylekhepvb8svideoplayer2725432193rootlapplicationbackgroundcolor ffffffleurs usagersultxtnew ol255 255 1stylek74xrrp41labelpour204 1bordersolid rgba47stylekbrn4j1hdropdownbackgroundcolorrgba255positionfixed importantleftauto importantzindex50avenirltw0185heavy1475544sansserif04sdchetsmetakeywordsseopagetitleseouzer1 0pxcursorpointer importantpositionfixed importantleftauto7b0b0b0daide au tripageuriseoapplicationmontrihidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidhuz0hdesktopbgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidhuz0hmobilebgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemkbrnkq4fmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsetitleurif77bf5a020a60c61ad4fce8023da9007d60f8bmv2pngwidth500height500altadvancedseodatatagstypemetapropsnamedescriptioncontentla10px 10px1bordersolid9n nninfosvgtypeshapeviewbox0 00s backgroundcolor 04s04s ease 0s1bordersolid rgba47 46204 1bordersolid200bbox20selectdatapreviewhover412sans112 0stylek74xrrp41labelwrapper0 200 200bbox20collectivits localesdestinemobilevotrefont normal normalstylek74xrrp41link255 1vos usagersaccompagner leurswidth100255 1 stylek74nknjfnavcontainern nninfosvgtypeshapeviewbox0montrihidetitletrueicondescriptionseola solution0s backgroundcolormargin0 4pxselectdatapreviewfocusrgba470px 0positionrelativewhitespacenowrap100sles5200 200bbox20249 1backgroundcolorrgba255 2551backgroundcolorrgba255 255 255dans la gestionpositionabsolutetop0right0bottom0left0nmobile villes249 249 1backgroundcolorrgba255stylek74nknjfnavcontainersvgcontaineraux collectivitspointereventsnonepath fillf470001bordersolid rgba47transitioncolorau tripageuriseoapplicationmontrihidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidhuz0hdesktopbgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidhuz0hmobilebgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemkbrnkq4fmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsetitleurif77bf5a020a60c61ad4fce8023da9007d60f8bmv2pngwidth500height500altadvancedseodatatagstypemetapropsnamedescriptioncontentlanninfosvgtypeshapeviewbox0normal normal 18px14emrgba47 46avenirltw0135light1475496sansserif color000000dchetstypetitlechildrenuzer application0positionrelativewhitespacenowrapstylekbrn4j1hcurrentlanguage18px14emrgba47 46 46stylek9u4yvc2labelwrapperstylek74nknjfnavcontainerarrowstylek74nknjfnavcontainerleftdirectionpointsstylek75xjst4labelwrapper3stylekbrn4j1hlanguagebuttonleftbackgroundcolorrgba204absolutetopstylekbrn4j1hmobilelanguageselectoravenirltw0135light1475496sansserifcolorrgba2440 14pxcalc10px 0pxautonninfosvgtypeshapeviewbox0 0 200tripageuriseoapplicationmontrihidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidhuz0hdesktopbgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidhuz0hmobilebgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemkbrnkq4fmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsetitleurif77bf5a020a60c61ad4fce8023da9007d60f8bmv2pngwidth500height500altadvancedseodatatagstypemetapropsnamedescriptioncontentla solutionnormal 16px14em avenirltw0185heavy1475544sansserifdisplaynonemontridchetsimportantleftautodaide au

Longtail Keyword Density for Uzer.eu

KeywordsOccurences
margin-left calc100 980px85
calc100 980px 0585
04s ease 0s17
font normal normal11
normal normal normal11
aux collectivits locales10
accompagner leurs usagers9
solution de rfrence9
rfrence destine aux9
destine aux collectivits9
collectivits locales pour9
locales pour accompagner9
pour accompagner leurs9
leurs usagers dans9
dans la gestion9
gestion de leurs9
application mobile villes9
mobile villes daide9
villes daide au9
n n nninfosvgtypeshapeviewbox08
n nninfosvgtypeshapeviewbox0 08
fontnormal normal normal7
rgba47 46 467
nninfosvgtypeshapeviewbox0 0 2007
46 46 16
background-colorrgba204 204 2045
10px 10px 10px5
204 1bordersolid rgba475
204 204 1bordersolid5
1bordersolid rgba47 465
ease 0s background-color5
255 255 15
112 0 15
rgba244 112 05
0s background-color 04s5
background-color 04s ease5
transitioncolor 04s ease5
positionabsolutetop0right0bottom0left0transitionborder-color 04s ease5
0 1 0pxcursorpointer4
255 1 style-k74nknjfnavcontainer4
1 0pxcursorpointer important4
1background-colorrgba255 255 2554
249 1background-colorrgba255 2554
border-stylesolidborder-colorrgba249 249 2494
border-width2px border-stylesolidborder-colorrgba249 2494
normal normal 16px14em4
249 249 1background-colorrgba2554
background-colorrgba255 255 2554
46 1 0px4
0px 0px 0positionrelativewhite-spacenowrap4
1bordersolid rgba244 1124
border-radius20px positionabsolutetop0right0bottom0left0transitionborder-color 04s4
daide au tripageuriseoapplication-montrihidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidhuz0hdesktopbgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidhuz0hmobilebgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-kbrnkq4fmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsetitleurif77bf5a020a60c61ad4fce8023da9007d60f8bmv2pngwidth500height500altadvancedseodatatagstypemetapropsnamedescriptioncontentla3
normal normal 20px14em3
normal normal 18px14em3
dchetstypetitlechildrenuzer application mobile3
leurs dchetstypetitlechildrenuzer application3
au tripageuriseoapplication-montrihidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidhuz0hdesktopbgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidhuz0hmobilebgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-kbrnkq4fmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsetitleurif77bf5a020a60c61ad4fce8023da9007d60f8bmv2pngwidth500height500altadvancedseodatatagstypemetapropsnamedescriptioncontentla solution3
positionstaticbox-shadow000 0 03
positionfixed importantleftauto importantz-index503
normal 16px14em avenir-lt-w0185-heavy1475544sans-serif3
0px calc10px 0px3
dchetsmetakeywordsseopagetitleseouzer application mobile3
leurs dchetsmetakeywordsseopagetitleseouzer application3
margin0 14px 03
background-colorrgba244 112 03
avenir-lt-w0185-heavy1475544sans-serif transitioncolor 04s3
0 200 200bbox203
margin-left calc10085
calc100 980px85
980px 0585
normal normal32
04s ease18
ease 0s17
255 25516
0 014
font normal11
aux collectivits10
10px 10px10
collectivits locales10
mobile villes9
rfrence destine9
villes daide9
204 2049
application mobile9
usagers dans9
daide au9
destine aux9
locales pour9
pour accompagner9
accompagner leurs9
leurs usagers9
n n8
nninfosvgtypeshapeviewbox0 08
n nninfosvgtypeshapeviewbox08
112 08
margin0line-heightnormalletter-spacingnormal txtnew7
0 2007
rgba47 467
fontnormal normal7
46 467
14px 06
vos usagers6
46 16
0 14px5
style-kbrn4j1hlanguagebuttonlabelstyle-kbrn4j1hlanguagebuttonhas-text margin05
style-kbrn4j1hdropdown style-kbrn4j1hdropdownwrapper5
204 1bordersolid5
background-colorrgba204 2045
0 15
1bordersolid rgba475
rgba244 1125
transitioncolor 04s5
positionabsolutetop0right0bottom0left0transitionborder-color 04s5
0s background-color5
background-color 04s5
255 15
1 style-k74nknjfnavcontainer5
background-colorrgba255 2554
border-stylesolidborder-colorrgba249 2494
border-width2px border-stylesolidborder-colorrgba2494
249 1background-colorrgba2554
249 2494
0px 0positionrelativewhite-spacenowrap4
txtnew ul4
97 24
1bordersolid rgba2444
border-radius20px positionabsolutetop0right0bottom0left0transitionborder-color4
margin0 4px4
background-color ffffff4
color ffffff4
avenir-lt-w0135-light1475496sans-serif color0000004
0px 0px4
1 0pxcursorpointer4
0pxcursorpointer important4
normal 16px14em4
1 0px4
1background-colorrgba255 2554
dchetsmetakeywordsseopagetitleseouzer application3
au tripageuriseoapplication-montrihidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidhuz0hdesktopbgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidhuz0hmobilebgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-kbrnkq4fmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsetitleurif77bf5a020a60c61ad4fce8023da9007d60f8bmv2pngwidth500height500altadvancedseodatatagstypemetapropsnamedescriptioncontentla3
normal 18px14em3
5px 5px3
dchetstypetitlechildrenuzer application3
normal 20px14em3
importantleftauto importantz-index503
leurs dchetstypetitlechildrenuzer3
tripageuriseoapplication-montrihidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidhuz0hdesktopbgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidhuz0hmobilebgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-kbrnkq4fmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsetitleurif77bf5a020a60c61ad4fce8023da9007d60f8bmv2pngwidth500height500altadvancedseodatatagstypemetapropsnamedescriptioncontentla solution3
positionfixed importantleftauto3
leurs dchetsmetakeywordsseopagetitleseouzer3
style-k74nknjfnavcontainerarrow style-k74nknjfnavcontainersvgcontainer3
montrihidetitletrueicondescriptionseola solution3
margin0 14px3
avenir-lt-w0185-heavy1475544sans-serif transitioncolor3
16px14em avenir-lt-w0185-heavy1475544sans-serif3
0px calc10px3
calc10px 0px3
path fillf470003
50 503
ol ul3
ultxtnew ol3
des usagers3
style-kbrn4j1hlanguagebuttoniconstyle-kbrn4j1hlanguagebuttonhas-icon margin03
4px style-kbrn4j1hlanguagebuttoncenter3
background-colorrgba244 1123
positionstaticbox-shadow000 03
selectdata-previewerror style-k74nknjfnavcontainerarrow3
lapplication montri3
vos points3
200 200bbox203
calc10085
980px85
margin-left85
0585
058
normal53
background-color42
color36
132
221
leurs20
ease20
et19
usagers19
0px19
318
txtnew18
04s18
0s17
margin016
10px16
vos16
positionabsolutetop0right0bottom0left016
n16
pour14
414
important14
aux13
style-k74nknjfnavcontainer13
application13
dans11
14px11
style-k74nknjfnavcontainerarrow11
mobile11
avenir-lt-w0185-heavy1475544sans-serif11
font11
ul10
ffffff10
collectivits10
locales10
gestion10
solution10
style-khepvb8s10
au10
accompagner9
daide9
1bordersolid9
rfrence9
59
villes9
destine9
68
nninfosvgtypeshapeviewbox08
collecte8
votre8
78
transform8
style-kbrn4j1hlanguagebutton7
style-kbrn4j1hdropdown7
margin0line-heightnormalletter-spacingnormal7
ol7
4px7
style-kbrn4j1hlanguagebuttonarrow-icon7
var7
avenir-lt-w0135-light1475496sans-serif7
fontnormal7
87
rgba477
svg6
style-k74nknjfnavcontainerarrowstyle-k74nknjfnavcontainerleft-direction6
des6
style-kbrn4j1hdropdownwrapper6
montri6
5px6
style-kbrn4j1hhorizontal6
lapplication6
style-kbrn4j1hlanguagebuttonlabelstyle-kbrn4j1hlanguagebuttonhas-text6
style-k74nknjfnavcontainerarrowstyle-k74nknjfnavcontainerright-direction6
style-k74nknjfnavcontainerarrowstyle-k74nknjfnavcontainercenter-direction6
color0000006
padding06
style-kbrn4j1hlanguagebuttonleft5
style-kbrn4j1hlanguagebuttonright5
if5
style-khepvb8svideoplayer2725432193root5
background-colorrgba2045
le5
les5
width1005
justify-contentcenter5
dchets5
rgba2445
justify-contentflex-start5
justify-contentflex-end5
positionabsolutetop0right0bottom0left0transitionborder-color5
text-aligninitialdisplayflexalign-itemscenter5
transitioncolor5
ultxtnew5
0positionrelativewhite-spacenowrap5
style-k8jvju0flabelwrapper4
94
style-k8jvju0flink4
style-k8jvju0flabel4
104
style-k8jvijqglabel4
une4
style-k9u4yvc2labelwrapper4
1px4
lb1itemscontainer4
style-k9u4yvc2link4
style-k9u4yvc2label4
100width4
sur4
notre4
avec4
style-k8jvijqglabelwrapper4
tri4
style-k8jvijqglink4
style-kbrn4j1hlanguagebuttonlast-child4
style-k75xjst4label4
114
1background-colorrgba2554
border-stylesolidborder-colorrgba2494
border-radius20px4
border-width2px4
style-k74nknjfrepeaterbuttonlabel4
style-k74xrrp41labelwrapper4
background-colorrgba2554
style-k74xrrp41label4
0pxcursorpointer4
b0b0b04
style-k74xrrp41link4
colorf470004
colorffffff4
style-k75xjst4link4
style-k75xjst4labelwrapper4
16px14em4
style-kbrn4j1hlanguagebuttoncenter4
displaynone4
style-kbrn4j1hlanguagebuttoniconstyle-kbrn4j1hlanguagebuttonhas-icon4
path4
disponible3
select3
dchetsmetakeywordsseopagetitleseouzer3
points3
200bbox203
tripageuriseoapplication-montrihidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidhuz0hdesktopbgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidhuz0hmobilebgmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-kbrnkq4fmetadatapageidhuz0hispresetfalseschemaversion20ishiddenfalsetitleurif77bf5a020a60c61ad4fce8023da9007d60f8bmv2pngwidth500height500altadvancedseodatatagstypemetapropsnamedescriptioncontentla3
web3
sans3
20px14em3
solid3
style-k0qpe55lbg3
dchetstypetitlechildrenuzer3
18px14em3
importantz-index503
importantleftauto3
montrihidetitletrueicondescriptionseola3
positionfixed3
topautobottom03
selectfocus3
0003
strc1data-responsive3
background-colorrgba2443
style-kbrn4j1hlanguagebuttoncenterstyle-kbrn4j1hlanguagebuttonhorizontal3
20px3
style-kbrn4j1hlanguagebuttonspacer3
fillf470003
style-kbrn4j1hlanguagebuttonicon3
style-kbrn4j1hmobilelanguageselector3
calc10px3
style-kbrn4j1hcurrentlanguage3
absolutetop3
pointer-eventsnone3
strc1inlinecontent3
style-k74nknjfnavcontainersvgcontainer3
oldirrtl3
positionstaticbox-shadow0003
auto3
style-k74nknjfnavcontainercenter-direction3
style-k74nknjfnavcontainerright-direction3
services3
selectdata-previewerror3
selectdata-errortrue3
selectdata-previewfocus3
selectdata-previewhover3
selecthover3
style-k74nknjfnavcontainerleft-direction3
123

Who hosts Uzer.eu?

Uzer.eu Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:GOOGLE
Hosted Country:United StatesUS
Location Latitude:41.2591
Location Longitude:-95.8517
Webserver Software:Pepyaka/1.19.0

Is "GOOGLE" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%

HTTP Header Analysis for Uzer.eu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 06 Apr 2021 02:05:41 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1617674741.562903323771116529
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
strict-transport-security: max-age=120
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVhP3UVzDz9CrWcUvFvX3Kki,qquldgcFrj2n046g4RNSVO38E53VHF73OUfaaLx5QS1YgeUJqUXtid 86vZww nL,2d58ifebGbosy5xc FRaliDQp8sNOOvdZELsIHz3Z5eXABvY5yESt4YeHSEWC3ncGgqFbFMYwiXnFojPwdof6Hbp5ZFqV5gBwiHjHfjWx2A=,2UNV7KOq4oGjA5 PKsX47BxIqOBp/BcxgT00NVTD1Qk=,9n3wTMzaU7zAZzBAj7gVUwc78piZB0gi6dY5GOmK3jnLKDws4xGQebY9XOx30tYJVnd8Z4jLK9R467MyhrzM6w==,l7Ey5khejq81S7sxGe5Nk2YxpuKClbeCoqNH/GJosGqTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,Ts 7R/4FijtA6c9psi3FQOYzUeIHn82gcBtubtPKj8iTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LoUK8/saGAmOxZWtpubo2tPw3SC20C/rG6xep4PHbjj6 SlnCcQF/6rIB8T103snQ1Xc9gJw9CSkxxyyHP50Ww==,Ts 7R/4FijtA6c9psi3FQOYzUeIHn82gcBtubtPKj8iTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,Ts 7R/4FijtA6c9psi3FQAfN05YL7KLm7fVBQsDoeJFNG KuK VIZfbNzHJu0vJu,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHEZjYEq wvqXy4qslUdeCGXFGjgaktx5qKl/w74g6vnFkmG5VidfiODQol1/quSTDw=,Ts 7R/4FijtA6c9psi3FQAfN05YL7KLm7fVBQsDoeJFNG KuK VIZfbNzHJu0vJu,l7Ey5khejq81S7sxGe5Nk213k A5xfzPFHTD wOjWZ1Xz5t7NzGxeu2CXkk1aB7ZGlsroP2XR0N rjgJK/PU9A==,CU5GbgCT5nWPaA3tUS4mLK6KJl1HEvulNIPSs0jZa6SBMd1drmlJsMG0Kj6wUYXXklacf7eCpnAyvf7c xtx8FiB5QmpRe2J37zq9nDD6cs=
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
cache-control: private,max-age=0,must-revalidate
Content-Encoding: gzip
Server: Pepyaka/1.19.0

Uzer.eu Domain Nameserver Information

HostIP AddressCountry
ns2.nom-domaine.fr 212.129.3.64
ns1.nom-domaine.fr 46.105.50.13


Need to find out who hosts Uzer.eu?


Domain Registration (WhoIs) information for Uzer.eu

 % The WHOIS service offered by EURid and the access to the records
% in the EURid WHOIS database are provided for information purposes
% only. It allows persons to check whether a specific domain name
% is still available or not and to obtain information related to
% the registration records of existing domain names.
%
% EURid cannot, under any circumstances, be held liable in case the
% stored information would prove to be wrong, incomplete or not
% accurate in any sense.
%
% By submitting a query you agree not to use the information made
% available to:
%
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or
% otherwise;
% - target advertising in any possible way;
%
% - to cause nuisance in any possible way to the registrants by sending
% (whether by automated, electronic processes capable of enabling
% high volumes or other possible means) messages to them.
%
% Without prejudice to the above, it is explicitly forbidden to extract,
% copy and/or use or re-utilise in any form and by any means
% (electronically or not) the whole or a quantitatively or qualitatively
% substantial part of the contents of the WHOIS database without prior
% and explicit permission by EURid, nor in any attempt hereof, to apply
% automated, electronic processes to EURid (or its systems).
%
% You agree that any reproduction and/or transmission of data for
% commercial purposes will always be considered as the extraction of a
% substantial part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept
% that EURid can take measures to limit the use of its WHOIS services
% in order to protect the privacy of its registrants or the integrity
% of the database.
%
% The EURid WHOIS service on port 43 (textual whois) never
% discloses any information concerning the registrant.
% Registrant and on-site contact information can be obtained through use of the
% webbased WHOIS service available from the EURid website www.eurid.eu
%
% WHOIS uzer.eu
Domain: uzer.eu
Script: LATIN

Registrant:
NOT DISCLOSED!
Visit www.eurid.eu for webbased WHOIS.

Technical:
Organisation: VIADUC
Language: fr
Email: Login to show email
VIADUC
Website: http://www.nom-domaine.fr

Name servers:
ns2.nom-domaine.fr
ns1.nom-domaine.fr

Please visit www.eurid.eu for more info.

Websites with Similar Names

Uzer.eu
UZER | Application mobile Villes d'aide au tri
Uzer.link
Uzerate
Uzer44.com
Uzer44 Домашняя Страница
Uzerapi.com
Uzerapi.com

Recently Updated Websites

Walkforgiants.org (7 seconds ago.)Myautothread.com (8 seconds ago.)Laramaxen.net (12 seconds ago.)Promoplan.com (16 seconds ago.)Buy-sanantonio.com (17 seconds ago.)Voteforbruno.com (17 seconds ago.)Sudachok.net (24 seconds ago.)Hgphotographics.com (25 seconds ago.)Joesbars.com (26 seconds ago.)Wizard.co.rs (26 seconds ago.)Bootstrapfilms.com (30 seconds ago.)Williamreder.com (31 seconds ago.)Architectelevator.com (32 seconds ago.)Rcct.com (32 seconds ago.)Muchcars.com (37 seconds ago.)Akomfort.com.ua (40 seconds ago.)Houselvs.com (42 seconds ago.)Itunescards.net (43 seconds ago.)Philpotttoyota.com (45 seconds ago.)Vegansanitizer.com (49 seconds ago.)Yazinga.com (51 seconds ago.)Signaturefinancememphis.com (53 seconds ago.)Czwlb.com (53 seconds ago.)Olapets.net (55 seconds ago.)Monarchcountry.net (55 seconds ago.)Puravidapatagonia.com.ar (55 seconds ago.)Novosanatizer.com (56 seconds ago.)Kokbet6897.com (1 minute 1 second ago.)Thedrinkingdress.com (1 minute 2 seconds ago.)Thestonearchgroup.com (1 minute 2 seconds ago.)

Recently Searched Keywords

h-i elektro (2 seconds ago.)seo- web- (2 seconds ago.)iisl (3 seconds ago.)big-deals inner col-333 (4 seconds ago.)会社案内(特定商取引表示) (5 seconds ago.)vacatures (6 seconds ago.)early introduction and food allergy prevention (6 seconds ago.)our charities (6 seconds ago.)lycee theodore monod abu dhabi fournitures (6 seconds ago.)property of metal class 8 (6 seconds ago.)sauna (6 seconds ago.)travemünde (6 seconds ago.)98043 regence (6 seconds ago.)акты (6 seconds ago.)bigscoots (6 seconds ago.)trek bike superstore san marcos (7 seconds ago.)area 702 (8 seconds ago.)подробнее подробней (9 seconds ago.)杏吧空降女友 (12 seconds ago.)height 10 padding-top (13 seconds ago.)h155 (13 seconds ago.)functional movement therapy (13 seconds ago.)alpha httpsamznto2cui8eu stabilo (13 seconds ago.)набор для восстановления резьбы м8х1 25 (14 seconds ago.)populære søk (15 seconds ago.)nagarjuna son (17 seconds ago.)view all campaigns (17 seconds ago.)обсуждаемое (17 seconds ago.)disease control priorities network (dcpn) (17 seconds ago.)dujos (1) (17 seconds ago.)