The leader in outcome-based marketing | Epsilon

Safety: Low trust score
Year Founded: 06
Global Traffic Rank: Unknown
Estimated Worth: $9

We create enriched customer experiences that drive performance at the individual and business level, enabling marketing built on proof, not promises.

Useful Searches

valueclick media

,


Domain summary

Last updated
2021-05-22
Domain label
valueclickmedia
Domain extension
co.uk
Domain registered:
06-Oct-2008
Domain updated:
04-Sep-2020
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Valueclickmedia.co.uk registered?
A: Valueclickmedia.co.uk was registered 12 years, 9 months, 3 weeks, 6 days, 2 hours, 47 minutes, 4 seconds ago on Monday, October 6, 2008.
Q: When was the WHOIS for Valueclickmedia.co.uk last updated?
A: The WHOIS entry was last updated 10 months, 4 weeks, 2 hours, 47 minutes, 4 seconds ago on Friday, September 4, 2020.
Q: What are Valueclickmedia.co.uk's nameservers?
A: DNS for Valueclickmedia.co.uk is provided by the following nameservers:
  • ns1.cnvr.net
  • ns2.cnvr.net
Q: Who is the registrar for the Valueclickmedia.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Valueclickmedia.co.uk?
A: Valueclickmedia.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Valueclickmedia.co.uk each day?
A: Valueclickmedia.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Valueclickmedia.co.uk resolve to?
A: Valueclickmedia.co.uk resolves to the IPv4 address 159.127.40.163.
Q: In what country are Valueclickmedia.co.uk servers located in?
A: Valueclickmedia.co.uk has servers located in the United States.
Q: What webserver software does Valueclickmedia.co.uk use?
A: Valueclickmedia.co.uk is powered by CloudFlare webserver.
Q: Who hosts Valueclickmedia.co.uk?
A: Valueclickmedia.co.uk is hosted by VALUECLICK in California, Agoura Hills, United States, 91301.
Q: How much is Valueclickmedia.co.uk worth?
A: Valueclickmedia.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Valueclickmedia.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Valueclickmedia.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Valueclickmedia.co.uk

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Valueclickmedia.co.uk

ourmoreinsightsrepublicislandscategorycorehighmarketingdrivepleaseaccuratefunctionresponse consolelogyou indeedifbrandsdrivespeoplemediaturn1retailertagsdigital media solutionsfinancialuse ourcallback functionresponsebesteventuse our siteimpactuseepsilonbrandtagsdigital mediamessagingsitekeyretail mediaexistingwavestrongmedia networkservicesbrandfunctionresponseboostsconsumerdigitalour sitetoployaltyacquisitionnotaudienceautoefficiencynot a robotservicesfeatured0listingordernulltitleefficientlyinmarketnetworkjavascript to useplease turnconnectionsolutionslinknameletsleadstheiridentitypersonalizedjavascript6lfmfwaaaaaaleu9ljnerbcn9mfnbgxkqedxd callback functionresponseretailertagsdigitalcustomersdigital media solutionsindeedboostnewemailfunctioncruiserightconnectionstimelinknameletsupdatasitekey 6lfmfwaaaaaaleu9ljnerbcn9mfnbgxkqedxdwemedia solutionssalesbetterfunctionresponse consolelogyoupartner0solutionsfinancial servicesfeatured0listingordernulltitleefficientlyleadercustomercontentretailhealthycallback functionresponse consolelogyou6lfmfwaaaaaaleu9ljnerbcn9mfnbgxkqedxd callbackindustryretailertagsdigital mediaarabright timelinknameletsthroughnullitssiteyourconsolelogyouqualityallstrategycallbackdmsusturn on javascriptwhybrandtagsdigitalsitekey 6lfmfwaaaaaaleu9ljnerbcn9mfnbgxkqedxd callbackindustrysnamedconsolelogyou indeedvarmedia solutionsfinancial servicesfeatured0listingordernulltitleefficientlypublishersmedia solutionsfinancial6lfmfwaaaaaaleu9ljnerbcn9mfnbgxkqedxdengagementsolutionsfinancialdemocraticdigital mediatvindeed are notrobotnetworkinfo

Longtail Keyword Density for Valueclickmedia.co.uk

KeywordsOccurences
turn on javascript12
javascript to use12
use our site12
digital media solutions3
retailertagsdigital media solutionsfinancial3
media solutionsfinancial servicesfeatured0listingordernulltitleefficiently3
sitekey 6lf-mfwaaaaaaleu9ljnerbcn9mfnbgxkqe-dxd callback3
6lf-mfwaaaaaaleu9ljnerbcn9mfnbgxkqe-dxd callback functionresponse3
callback functionresponse consolelogyou3
functionresponse consolelogyou indeed3
indeed are not3
not a robot3
media solutionsfinancial13
please turn12
use our12
our site12
brandtagsdigital media5
retailertagsdigital media5
media solutions4
digital media4
callback functionresponse4
media network3
right timelinknamelets3
retail media3
solutionsfinancial servicesfeatured0listingordernulltitleefficiently3
sitekey 6lf-mfwaaaaaaleu9ljnerbcn9mfnbgxkqe-dxd3
6lf-mfwaaaaaaleu9ljnerbcn9mfnbgxkqe-dxd callback3
functionresponse consolelogyou3
consolelogyou indeed3
media57
customer18
our17
right15
site13
solutionsfinancial13
please12
javascript12
use12
customers12
turn12
digital12
var11
data10
your10
loyalty10
new10
marketing10
their9
email8
dms7
solutions7
null7
republic7
up7
through7
connection6
06
epsilon6
retail6
us6
brands6
core6
more6
content6
linknamelets5
function5
retailertagsdigital5
engagement5
not5
brandtagsdigital5
top5
consumer5
messaging5
drive4
boosts4
audience4
personalized4
functionresponse4
insights4
sales4
accurate4
leader4
best4
callback4
cruise4
all4
brand4
sitekey4
servicesfeatured0listingordernulltitleefficiently4
why4
strong4
we4
existing3
indeed3
consolelogyou3
event3
6lf-mfwaaaaaaleu9ljnerbcn9mfnbgxkqe-dxd3
islands3
if3
wave3
networkinfo3
named3
13
democratic3
arab3
tv3
better3
quality3
partner3
its3
acquisition3
category3
industrys3
identity3
network3
publishers3
people3
services3
auto3
industry3
leads3
connections3
boost3
strategy3
healthy3
high3
impact3
in-market3
timelinknamelets3
efficiency3
drives3
robot3

Who hosts Valueclickmedia.co.uk?

Valueclickmedia.co.uk Hosting Provider Information

Hosted IP Address:159.127.40.163
Hosted Hostname:159.127.40.163
Service Provider:VALUECLICK
Hosted Country:United StatesUS
Location Latitude:34.1227
Location Longitude:-118.7573
Webserver Software:CloudFlare

Is "VALUECLICK" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
16.3509%
Unknown
7.9282%
AS-26496-GO-DADDY-COM-LLC
4.2120%
NAMECHEAP-NET
3.4686%
AMAZON-AES
2.5797%
GoDaddy.com, LLC
2.3421%
UNIFIEDLAYER-AS-1
2.2322%
Fara Negar Pardaz Khuzestan
1.8901%
CONFLUENCE-NETWORK-INC
1.6374%
1&1 Internet AG
1.5839%
VALUECLICK
0.0000%

HTTP Header Analysis for Valueclickmedia.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 22 May 2021 12:30:56 GMT
Content-Type: text/html;charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
CF-Ray: 65360f016dbb40cc-LHR
Age: 5918
Cache-Control: s-maxage=7200,max-age=5
Content-Encoding: gzip
Link:; rel=preload; as=script, ; rel=preload; as=script
Strict-Transport-Security: max-age=0
Vary: Accept-Encoding
CF-Cache-Status: HIT
Access-Control-Allow-Credentials: false
cf-request-id: 0a35a7b4de000040cc3d8f7000000001
Content-Security-Policy: upgrade-insecure-requests
Edge-Cache-Tag: CT-40917166601,P-2323601,W-1611357856141,W-1611358999647,W-1611359714046,W-1612222100831,W-1619736604896,W-1620744578947,CW-40086339381,CW-40101447856,CW-40101447872,CW-40101447880,CW-40101666888,CW-40103310552,CW-40672122609,CW-46389313377,DB-3409879,DB-3409880,DB-3409882,E-40084013929,E-40084013931,E-40084013932,E-40084013935,E-40085664540,E-40100839616,E-40100839619,E-40100839625,E-40101447903,E-40101447910,E-40101666907,E-40101666909,E-40101666914,E-40103310593,E-40103310595,E-40103310598,E-40103310602,E-40103310614,E-40104061301,E-40106652161,E-40671805302,E-41157887830,E-44076473444,E-45466038360,E-45466184469,E-46388910494,MENU-40102233196,MENU-40102285141,RA-40103310495,PGS-ALL,SW-0,B-31717711532,B-5300481688,B-6385070514,B-6640275229,TS-40103310524
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Referrer-Policy: no-referrer-when-downgrade
X-HS-Cache-Config: BrowserCache-5s-EdgeCache-7200s
X-HS-Combine-CSS: Bot
X-HS-Content-Id: 40917166601
X-HS-Hub-Id: 2323601
X-HubSpot-Correlation-Id: 9fd53bfa-0416-4400-887b-99147f821b74
X-Powered-By: HubSpot
X-Trace: 2B6695D4D92053A4F1A1AC9BB9A01CB80A27D5006E000000000000000000
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=WDEpYG/5eG1nHa+CDLKD0IOn2swo1f2wMcQZoXNr26bMT96+5+wYAV8N7SxaTVetxy02yvA15txHhEZuX8/G62S80QGRw97eCuGe77Dugyw="}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Valueclickmedia.co.uk Domain Nameserver Information

HostIP AddressCountry
ns1.cnvr.net 159.127.43.23
ns2.cnvr.net 159.127.40.145


Need to find out who hosts Valueclickmedia.co.uk?


Domain Registration (WhoIs) information for Valueclickmedia.co.uk

 Domain name:
valueclickmedia.co.uk

Data validation:
Nominet was not able to match the registrant's name and/or address against a 3rd party source on 30-Aug-2018

Registrar:
Markmonitor Inc. t/a MarkMonitor Inc. [Tag = MARKMONITOR]
URL: http://www.markmonitor.com

Relevant dates:
Registered on: 06-Oct-2008
Expiry date: 06-Oct-2021
Last updated: 04-Sep-2020

Registration status:
Registered until expiry date.

Name servers:
ns1.cnvr.net
ns2.cnvr.net

WHOIS lookup made at 13:30:57 22-May-2021

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2021.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Value-a-business.com
HOME | Pete Smith
Value-ability.com
Value-Ability Podcast - Financial Planning Podcast, Financial Advisor
Value-account.eu
System Maintenance
Value-action.com
Value Action : Conseil opérationnel & Transition managériale
Value-added.org
Illinois Institute for Rural Affairs – Value-Added Sustainable Development Center

Recently Updated Websites

Blaskdemo.wordpress.com (6 seconds ago.)Mitochondrialrevitalizer.com (7 seconds ago.)Fencecompanyofirvine.com (14 seconds ago.)Ptergallprispen.ml (16 seconds ago.)Hennikerathletics.org (23 seconds ago.)Agrofamily.org (24 seconds ago.)Francohost.com (25 seconds ago.)Seeyouchengdu.com (29 seconds ago.)Autobazar-pataki.cz (35 seconds ago.)Comfyearrings.org (36 seconds ago.)Neo-acg.net (36 seconds ago.)Ifciexam.org (37 seconds ago.)Whisperonline.com (37 seconds ago.)Crazytim.dev (39 seconds ago.)G2g289vip.com (42 seconds ago.)Mddcmils.com (45 seconds ago.)Correspondnow.com (46 seconds ago.)Utah100partners.com (47 seconds ago.)Gwithianservices.com (47 seconds ago.)Gamenightlife.com (53 seconds ago.)Djcyclecenter.com (55 seconds ago.)Tekelog.com (56 seconds ago.)Aoabet4323.vip (1 minute ago.)Elettromag.info (1 minute 1 second ago.)Istocko.com (1 minute 2 seconds ago.)Alicebiella.org (1 minute 5 seconds ago.)Elecom.kz (1 minute 6 seconds ago.)Netonius.com (1 minute 6 seconds ago.)Findfivefriends.net (1 minute 7 seconds ago.)Genkgo.com (1 minute 10 seconds ago.)

Recently Searched Keywords

wiid imgattrdata-uro-original jqueryattrsrc (1 second ago.)contact avec (2 seconds ago.)merchant (2 seconds ago.)li tdblocktemplate16widget (2 seconds ago.)supply recruitment payroll (2 seconds ago.)essential wordpress plugins (3 seconds ago.)bloxentertainment.com (4 seconds ago.)in remembrance of williwaw (7 seconds ago.)medication hive (8 seconds ago.)boissons (8 seconds ago.)路边石 (9 seconds ago.)pocket (9 seconds ago.)назад (10 seconds ago.)business and kelly (11 seconds ago.)sonbaron (12 seconds ago.)anonyme (13 seconds ago.)beekeeping so (14 seconds ago.)stretched (14 seconds ago.)round rapid feeders – white (15 seconds ago.)digital content (16 seconds ago.)top trending (16 seconds ago.)14px14em times (19 seconds ago.)2 frame (20 seconds ago.)bloxpolitics.com (21 seconds ago.)supplies u003cbr (21 seconds ago.)normal normal 25px14em (22 seconds ago.)asian magenta (24 seconds ago.)cc-by-sa 3.0 (24 seconds ago.)cabotage (26 seconds ago.)siteground hosting discount (26 seconds ago.)