Vasmegye.hu Favicon Vasmegye.hu

Vasmegye.hu Website Thumbnail
Checking...
Főoldal - Vas megye hivatalos honlapja
Low trust score
Add a review Change category Claim this site
Vas megye hivatalos honlapja – aktuális hírek, események, turizmus, fejlesztések, projektek, választások.


Domain summary

Domain label
vasmegye
Domain extension
hu
Domain registered:
2001-04-27
Domain updated:
2020-10-28
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is vasmegye.hu ranked relative to other sites:

Percentage of visits to vasmegye.hu from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Vasmegye.hu registered?
A: Vasmegye.hu was registered 19 years, 6 months, 2 days, 14 hours, 24 minutes, 41 seconds ago on Friday, April 27, 2001.
Q: When was the WHOIS for Vasmegye.hu last updated?
A: The WHOIS entry was last updated 1 day, 14 hours, 24 minutes, 41 seconds ago on Wednesday, October 28, 2020.
Q: What are Vasmegye.hu's nameservers?
A: DNS for Vasmegye.hu is provided by the following nameservers:
  • ns.savaria.hu
  • ns.microsystem.hu
Q: Who is the registrar for the Vasmegye.hu domain?
A: The domain has been registered at HUNIC.
Q: What is the traffic rank for Vasmegye.hu?
A: Vasmegye.hu has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Vasmegye.hu each day?
A: Vasmegye.hu receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Vasmegye.hu resolve to?
A: Vasmegye.hu resolves to the IPv4 address 185.187.73.28.
Q: In what country are Vasmegye.hu servers located in?
A: Vasmegye.hu has servers located in the Hungary.
Q: What webserver software does Vasmegye.hu use?
A: Vasmegye.hu is powered by Apache/2.4.10 (Debian) webserver.
Q: Who hosts Vasmegye.hu?
A: Vasmegye.hu is hosted by Fara Negar Pardaz Khuzestan in Budapest, Budapest, Hungary, 1115.
Q: How much is Vasmegye.hu worth?
A: Vasmegye.hu has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Vasmegye.hu?

Vasmegye.hu Hosting Provider Information

Hosted IP Address:185.187.73.28
Hosted Hostname:wp.prosupport.io
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:HungaryHU
Location Latitude:47.4984
Location Longitude:19.0404
Webserver Software:Apache/2.4.10 (Debian)

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Vasmegye.hu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 28 Oct 2020 11:33:33 GMT
Server: Apache/2.4.10 (Debian)
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link:; rel="https://api.w.org/", ; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 39584
Content-Type: text/html; charset=UTF-8

Vasmegye.hu Domain Nameserver Information

HostIP AddressCountry
ns.savaria.hu 77.221.39.2
ns.microsystem.hu 195.184.4.1


Need to find out who hosts Vasmegye.hu?


WhoIs information for Vasmegye.hu

 % Whois server 3.0 serving the hu ccTLD

domain: vasmegye.hu
record created: 2001-04-27 03:00:18
Tovabbi adatokert ld.:
http://www.domain.hu/domain/domainsearch/
For further data see:
http://www.domain.hu/domain/English/domainsearch/

Vasmegye.hu Free SEO Report

Website Inpage Analysis for Vasmegye.hu

H1 Headings

2 :
  1. KÖZADAT KERESŐ
  2. KÖZADAT KERESŐ

H2 Headings

14 :
  1. Üdvözöljük Vas megye weboldalán!
  2. Kitüntetéseket adtak át a megyeházán a nemzeti ünnep alkalmából
  3. Elkészült a RESTART_4Danube projekt első hírlevele!
  4. Tábornokká nevezték ki a Vas megyei katasztrófavédelmi igazgatót
  5. Közmeghallgatás
  6. Közmeghallgatás
  7. Vas Megyei Értéktár Kiadvány
  8. Üdvözöljük Vas megye weboldalán!
  9. Kitüntetéseket adtak át a megyeházán a nemzeti ünnep alkalmából
  10. Elkészült a RESTART_4Danube projekt első hírlevele!
  11. Tábornokká nevezték ki a Vas megyei katasztrófavédelmi igazgatót
  12. Közmeghallgatás
  13. Közmeghallgatás
  14. Széchenyi 2020 projektek

H3 Headings

20 :
  1. Következő esemény
  2. Időjárás
  3. Események kategóriák szerint
  4. Közérdekű adatok
  5. Közadat kereső
  6. Képgaléria
  7. Képgaléria kategóriák
  8. Keressen bennünket itt is...
  9. Következő esemény
  10. Időjárás
  11. Események kategóriák szerint
  12. Közérdekű adatok
  13. Közadat kereső
  14. Képgaléria
  15. Képgaléria kategóriák
  16. Keressen bennünket itt is...
  17. VAS MEGYÉRŐL
  18. Kapcsolat
  19. Következő esemény
  20. Turizmus

H4 Headings

18 :
  1. Helyi idő
  2. Ma
  3. csütörtök
  4. péntek
  5. szombat
  6. Megyebál 2020
  7. Vas Megyei Közgyűlés alakuló ülés - 2019. 10. 22.
  8. Megyenap 2019
  9. Köztisztviselői nap 2019
  10. Helyi idő
  11. Ma
  12. csütörtök
  13. péntek
  14. szombat
  15. Megyebál 2020
  16. Vas Megyei Közgyűlés alakuló ülés - 2019. 10. 22.
  17. Megyenap 2019
  18. Köztisztviselői nap 2019

H5 Headings

8 :
  1. 2020. október 28.
  2. 2020. október 29.
  3. 2020. október 30.
  4. 2020. október 31.
  5. 2020. október 28.
  6. 2020. október 29.
  7. 2020. október 30.
  8. 2020. október 31.

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

34 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-10472225-49

Links - Internal

153:
  1. Aktuális
    http://www.vasmegye.hu/vasi-hirmondo-2/
  2. Hírek
    http://www.vasmegye.hu/hirek/
  3. Vas megye havilap
    http://www.vasmegye.hu/vasmegye-havilap/
  4. Vasi Kaleidoszkóp
    http://www.vasmegye.hu/vasi-kaleidoszkop/
  5. Jelképek
    http://www.vasmegye.hu/megye/jelkepek/
  6. Címer
    http://www.vasmegye.hu/megye/jelkepek/cimer/
  7. Zászló
    http://www.vasmegye.hu/megye/jelkepek/zaszlo/
  8. Zenei szignál
    http://www.vasmegye.hu/megye/jelkepek/zenei-szignal/
  9. Történet
    http://www.vasmegye.hu/megye/tortenet/
  10. Földrajz
    http://www.vasmegye.hu/megye/foldrajz/
  11. Gazdaság
    http://www.vasmegye.hu/megye/gazdasag/
  12. Népesség
    http://www.vasmegye.hu/megye/nepesseg/
  13. Vas megye települései
    http://www.vasmegye.hu/vas-megye-telepulesei
  14. Nemzetiségek
    http://www.vasmegye.hu/megye/nemzetisegek/
  15. Horvát
    http://www.vasmegye.hu/megye/nemzetisegek/horvat/
  16. Német
    http://www.vasmegye.hu/megye/nemzetisegek/nemet/
  17. Roma
    http://www.vasmegye.hu/megye/nemzetisegek/roma/
  18. Szlovén
    http://www.vasmegye.hu/megye/nemzetisegek/szloven/
  19. Területi Önkormányzatok
    http://www.vasmegye.hu/megye/nemzetisegek/teruleti-onkormanyzatok/
  20. Folyóiratok
    http://www.vasmegye.hu/megye/folyoiratok/
  21. Vasi Ki-Kicsoda?
    http://www.vasmegye.hu/vasi-ki-kicsoda/
  22. Az Év Vasi Embere
    http://www.vasmegye.hu/az-ev-vasi-embere/
  23. Elnöki köszöntő
    http://www.vasmegye.hu/elnoki-koszonto/
  24. Közgyűlés
    http://www.vasmegye.hu/onkormanyzat/kozgyules/
  25. Bizottságok
    http://www.vasmegye.hu/onkormanyzat/bizottsagok/
  26. Döntéshozatal
    http://www.vasmegye.hu/onkormanyzat/donteshozatal/
  27. Ülések
    http://www.vasmegye.hu/onkormanyzat/donteshozatal/ulesek/
  28. Határozatok
    http://www.vasmegye.hu/onkormanyzat/donteshozatal/hatarozatok/
  29. Rendeletek
    http://www.vasmegye.hu/onkormanyzat/donteshozatal/rendeletek/
  30. Egyéb dokumentumok
    http://www.vasmegye.hu/onkormanyzat/donteshozatal/egyeb-dokumentumok/
  31. Dokumentumok
    http://www.vasmegye.hu/dokumentumok/
  32. Díjak, kitüntetések
    http://www.vasmegye.hu/onkormanyzat/dijak-kituntetesek/
  33. Március 15.
    http://www.vasmegye.hu/onkormanyzat/dijak-kituntetesek/marcius-15/
  34. Augusztus 20.
    http://www.vasmegye.hu/onkormanyzat/dijak-kituntetesek/augusztus-20/
  35. Október 23.
    http://www.vasmegye.hu/onkormanyzat/dijak-kituntetesek/oktober-23/
  36. December
    http://www.vasmegye.hu/onkormanyzat/dijak-kituntetesek/december/
  37. Nemzetközi kapcsolatok
    http://www.vasmegye.hu/nemzetkozi-kapcsolatok/
  38. Testvérmegyék
    http://www.vasmegye.hu/nemzetkozi-kapcsolatok/testvermegyek/
  39. Szervezetek
    http://www.vasmegye.hu/nemzetkozi-kapcsolatok/szervezetek/
  40. Küldetésnyilatkozat
    http://www.vasmegye.hu/kuldetesnyilatkozat/
  41. Hivatalvezető
    http://www.vasmegye.hu/hivatal/hivatalvezeto/
  42. Felépítés
    http://www.vasmegye.hu/hivatal/felepites/
  43. Elérhetőségek
    http://www.vasmegye.hu/hivatal/elerhetosegek/
  44. Koncepciók, tervek
    http://www.vasmegye.hu/fejlesztesek/koncepciok/
  45. Széchenyi2020
    http://www.vasmegye.hu/szechenyi-2020/
  46. Nemzetközi projektek
    http://www.vasmegye.hu/fejlesztesek/projektek/nemzetkozi-projektek/
  47. Egyéb projektek
    http://www.vasmegye.hu/fejlesztesek/projektek/egyeb-projektek/
  48. Vallási értékek
    http://www.vasmegye.hu/turizmus/vallasi-ertekek/
  49. Várak, kastélyok
    http://www.vasmegye.hu/turizmus/varak-kastelyok/
  50. Múzeumok, galériák
    http://www.vasmegye.hu/turizmus/muzumok-galeriak/
  51. Nemzeti Park, Natúrparkok
    http://www.vasmegye.hu/turizmus/nemzeti-park-naturparkok/
  52. Gyógy-és termálfürdők
    http://www.vasmegye.hu/turizmus/gyogy-es-termalfurdok/
  53. Tematikus utak
    http://www.vasmegye.hu/turizmus/tematikus-utak/
  54. Két keréken
    http://www.vasmegye.hu/ket-kereken/
  55. Túra ajánlatok
    http://www.vasmegye.hu/tura-ajanlatok/
  56. Kiadványok
    http://www.vasmegye.hu/kiadvanyok-2/
  57. Alkalmazások
    http://www.vasmegye.hu/alkalmazasok/
  58. Események
    http://www.vasmegye.hu/esemenyek
  59. Területi Választási Iroda
    http://www.vasmegye.hu/valasztas/teruleti-valasztasi-iroda/
  60. Területi Választási Bizottság
    http://www.vasmegye.hu/valasztas/teruleti-valasztasi-bizottsag/
  61. Dokumentumok
    http://www.vasmegye.hu/valasztas/dokumentumok/
  62. No text
    http://www.vasmegye.hu/
  63. DE
    http://www.vasmegye.hu/entdeckung-des-komitats-vas/
  64. En
    http://www.vasmegye.hu/discovering-vas-country/
  65. Vas Megyéért Egyesület
    http://www.vasmegye.hu/vas-megyeert-egyesulet/
  66. Közérdekű Adatok
    http://www.vasmegye.hu/kozerdeku-adatok/
  67. Családi
    http://www.vasmegye.hu/esemnykategria/csaladi/
  68. Egyéb rendezvény
    http://www.vasmegye.hu/esemnykategria/egyeb-rendezveny/
  69. Gasztronómia
    http://www.vasmegye.hu/esemnykategria/gasztronomia/
  70. Kulturális
    http://www.vasmegye.hu/esemnykategria/kulturalis/
  71. Megye/Önkormányzat
    http://www.vasmegye.hu/esemnykategria/megye-onkormanyzat/
  72. Sport / szabadidő
    http://www.vasmegye.hu/esemnykategria/sport-szabadido/
  73. Elérhetőségi adatok
    http://www.vasmegye.hu/hivatal/elerhetosegek/
  74. A Vas Megyei Közgyűlés
    http://www.vasmegye.hu/onkormanyzat/kozgyules/
  75. A Vas Megyei Közgyűlés Bizottságai
    http://www.vasmegye.hu/onkormanyzat/bizottsagok/
  76. Szervezeti felépítés
    http://www.vasmegye.hu/hivatal/felepites/
  77. Felügyelt költségvetési szervek
    http://www.vasmegye.hu/felugyelt-koltsegvetesi-szervek/
  78. Gazdálkodó szervezetek
    http://www.vasmegye.hu/gazdalkodo-szervezetek/
  79. Közalapítványok
    http://www.vasmegye.hu/kozalapitvanyok/
  80. Lapok
    http://www.vasmegye.hu/lapok/
  81. Felettes, felügyeleti, törvényességi ellenőrzést gyakorló szerv
    http://www.vasmegye.hu/felettes-felugyeleti-torvenyessegi-ellenorzest-gyakorlo-szerv/
  82. Költségvetési szervek
    http://www.vasmegye.hu/koltsegvetesi-szervek/
  83. Az önkormányzat feladatát, hatáskörét és alaptevékenységét meghatározó alapvető jogszabályok, állami irányítás egyéb eszközei, valamint a szervezeti és működési szabályzat ügyrendi listája
    http://www.vasmegye.hu/az-onkormanyzat-feladatat-hataskoret-es-alaptevekenyseget-meghatarozo-alapveto-jogszabalyok-allami-iranyitas-egyeb-eszkozei-valamint-a-szervezeti-es-mukodesi-szabalyzat-ugyrendi-listaja/
  84. A helyi önkormányzat önként vállalat feladatainak felsorolása és részletes leírása
    http://www.vasmegye.hu/a-helyi-onkormanyzat-onkent-vallalat-feladatainak-felsorolasa-es-reszletes-leirasa/
  85. A hatósági ügyek intézésének rendjével kapcsolatos adatok
    http://www.vasmegye.hu/a-hatosagi-ugyek-intezesenek-rendjevel-kapcsolatos-adatok/
  86. Közszolgáltatások
    http://www.vasmegye.hu/kozszolgaltatasok/
  87. A szerv nyilvántartásai
    http://www.vasmegye.hu/a-szerv-nyilvantartasai/
  88. Lapok (nyilvános kiadványok)
    http://www.vasmegye.hu/lapok-nyilvanos-kiadvanyok/
  89. A testület által alkotott rendeletek
    http://www.vasmegye.hu/onkormanyzat/donteshozatal/rendeletek/
  90. A testület által alkotott határozatok
    http://www.vasmegye.hu/onkormanyzat/donteshozatal/hatarozatok/
  91. Döntések előkészítésének rendje, eljárási szabályok (SZMSZ)
    http://www.vasmegye.hu/dontesek-elokeszitesenek-rendje-eljarasi-szabalyok-szmsz/
  92. Megyei közgyűlés ülései
    http://www.vasmegye.hu/ulesek/
  93. Pályázatok
    http://www.vasmegye.hu/fejlesztesek/koncepciok/
  94. Hirdetmények
    http://www.vasmegye.hu/hirdetmenyek/
  95. Közérdekű adatok igénylése
    http://www.vasmegye.hu/kozerdeku-adatok-igenylese/
  96. Közzétételi listák
    http://www.vasmegye.hu/kozzeteteli-listak/
  97. Vizsgálatok, ellenőrzések listája
    http://www.vasmegye.hu/vizsgalatok-ellenorzesek-listaja/
  98. Az Állami Számvevőszék ellenőrzései
    http://www.vasmegye.hu/az-allami-szamvevoszek-ellenorzesei/
  99. Egyéb ellenőrzések, vizsgálatok
    http://www.vasmegye.hu/egyeb-ellenorzesek-vizsgalatok/
  100. A működés eredményessége, teljesítmény, statisztika
    http://www.vasmegye.hu/a-mukodes-eredmenyessege-teljesitmeny-statisztika/
  101. Éves költségvetések
    http://www.vasmegye.hu/eves-koltsegvetesek/
  102. Számviteli beszámolók
    http://www.vasmegye.hu/szamviteli-beszamolok/
  103. A költségvetés végrehajtása
    http://www.vasmegye.hu/a-koltsegvetes-vegrehajtasa/
  104. Foglalkoztatottak
    http://www.vasmegye.hu/foglalkoztatottak/
  105. Támogatások
    http://www.vasmegye.hu/tamogatasok/
  106. Szerződések, egyéb kifizetések
    http://www.vasmegye.hu/szerzodesek-egyeb-kifizetesek/
  107. Európai Unió által támogatott fejlesztések
    http://www.vasmegye.hu/europai-unio-altal-tamogatott-fejlesztesek/
  108. Közbeszerzés
    http://www.vasmegye.hu/kozbeszerzes/
  109. No text
    http://www.vasmegye.hu/kepgaleria/megyebal-2020/
  110. Megyebál 2020
    http://www.vasmegye.hu/kepgaleria/megyebal-2020/
  111. No text
    http://www.vasmegye.hu/kepgaleria/vas-megyei-kozgyules-alakulo-ules-2019-10-22/
  112. Vas Megyei Közgyűlés alakuló ülés - 2019. 10. 22.
    http://www.vasmegye.hu/kepgaleria/vas-megyei-kozgyules-alakulo-ules-2019-10-22/
  113. No text
    http://www.vasmegye.hu/kepgaleria/megyenap-2019/
  114. Megyenap 2019
    http://www.vasmegye.hu/kepgaleria/megyenap-2019/
  115. No text
    http://www.vasmegye.hu/kepgaleria/koztisztviseloi-nap-2019/
  116. Köztisztviselői nap 2019
    http://www.vasmegye.hu/kepgaleria/koztisztviseloi-nap-2019/
  117. Még több kép...
    http://www.vasmegye.hu/kepgaleria/
  118. Projektek
    http://www.vasmegye.hu/kepgaleira/projektek/
  119. Rendezvények
    http://www.vasmegye.hu/kepgaleira/rendezvenyek/
  120. Szabadidő, sport
    http://www.vasmegye.hu/kepgaleira/sport/
  121. Vas megye
    http://www.vasmegye.hu/kepgaleira/vas-megye/
  122. No text
    http://www.vasmegye.hu/dom-etterem/
  123. No text
    http://www.vasmegye.hu/hirek/kitunteteseket-adtak-at-a-megyehazan-a-nemzeti-unnep-alkalmabol/
  124. Kitüntetéseket adtak át a megyeházán a nemzeti ünnep alkalmából
    http://www.vasmegye.hu/hirek/kitunteteseket-adtak-at-a-megyehazan-a-nemzeti-unnep-alkalmabol/
  125. Bővebben »
    http://www.vasmegye.hu/hirek/kitunteteseket-adtak-at-a-megyehazan-a-nemzeti-unnep-alkalmabol/
  126. No text
    http://www.vasmegye.hu/hirek/elkeszult-a-restart_4danube-projekt-elso-hirlevele/
  127. Elkészült a RESTART_4Danube projekt első hírlevele!
    http://www.vasmegye.hu/hirek/elkeszult-a-restart_4danube-projekt-elso-hirlevele/
  128. Bővebben »
    http://www.vasmegye.hu/hirek/elkeszult-a-restart_4danube-projekt-elso-hirlevele/
  129. No text
    http://www.vasmegye.hu/hirek/tabornokka-neveztek-ki-a-vas-megyei-katasztrofavedelmi-igazgatot/
  130. Tábornokká nevezték ki a Vas megyei katasztrófavédelmi igazgatót
    http://www.vasmegye.hu/hirek/tabornokka-neveztek-ki-a-vas-megyei-katasztrofavedelmi-igazgatot/
  131. Bővebben »
    http://www.vasmegye.hu/hirek/tabornokka-neveztek-ki-a-vas-megyei-katasztrofavedelmi-igazgatot/
  132. Közmeghallgatás
    http://www.vasmegye.hu/hirek/kozmeghallgatas-3/
  133. Bővebben »
    http://www.vasmegye.hu/hirek/kozmeghallgatas-3/
  134. Közmeghallgatás
    http://www.vasmegye.hu/hirek/kozmeghallgatas-2/
  135. Bővebben »
    http://www.vasmegye.hu/hirek/kozmeghallgatas-2/
  136. 2
    http://www.vasmegye.hu/page/2/
  137. 68
    http://www.vasmegye.hu/page/68/
  138. Következő →
    http://www.vasmegye.hu/page/2/
  139. No text
    http://www.vasmegye.hu/szechenyi-2020/
  140. No text
    http://www.vasmegye.hu/ertektarkiadvany2020_web/
  141. Vas Megyei Értéktár Kiadvány
    http://www.vasmegye.hu/ertektarkiadvany2020_web/
  142. Tovább
    http://www.vasmegye.hu/hirek/kitunteteseket-adtak-at-a-megyehazan-a-nemzeti-unnep-alkalmabol/
  143. Tovább
    http://www.vasmegye.hu/hirek/elkeszult-a-restart_4danube-projekt-elso-hirlevele/
  144. Tovább
    http://www.vasmegye.hu/hirek/tabornokka-neveztek-ki-a-vas-megyei-katasztrofavedelmi-igazgatot/
  145. Tovább
    http://www.vasmegye.hu/hirek/kozmeghallgatas-3/
  146. Tovább
    http://www.vasmegye.hu/hirek/kozmeghallgatas-2/
  147. 3
    http://www.vasmegye.hu/page/3/
  148. Következő »
    http://www.vasmegye.hu/page/2/
  149. Széchenyi 2020 projektek
    http://www.vasmegye.hu/szechenyi-2020/
  150. Impresszum
    http://www.vasmegye.hu/impresszum/
  151. Adatvédelmi tájékoztató
    http://www.vasmegye.hu/adatvedelem/
  152. Közérdekű adatok
    http://www.vasmegye.hu/kozerdeku-adatok/
  153. További információ
    http://www.vasmegye.hu/adatvedelem/

Links - Internal (nofollow)

0:

Links - Outbound

16:
  1. Vas Megyei Értéktár
    http://www.vasiertektar.hu/
  2. Vas Megyei Foglalkoztatási Paktum
    http://vasmegyeipaktum.hu/
  3. Vas Megyei Turizmus Szövetség
    https://visitvas.hu/
  4. Guide2Visit
    http://guide2visit.eu/
  5. Vasi Család És Karrier Pont
    https://www.facebook.com/csaladeskarrierpont/
  6. OpenWeatherMap.org
    http://openweathermap.org
  7. Összetett kereső »
    http://kozadat.hu/kereso/osszetett-kereso
  8. No text
    https://www.facebook.com/vasmegye.hu/
  9. No text
    https://www.instagram.com/vasmegye.hu/
  10. No text
    https://www.linkedin.com/company/local-government-office-of-vas-county
  11. No text
    https://www.youtube.com/channel/UC6Q0YHJAlP1PxEecwHlJTIg?view_as=subscriber
  12. No text
    https://www.azevhonlapja.hu/dijazottak/dijat-nyert-weboldalak-2018
  13. Vas megyei turizmus szövetség
    https://visitvas.hu/
  14. Vas megyéért egyesület
    https://vasmegyeert.hu/
  15. Guide2visit
    http://guide2visit.eu
  16. Vasi család és karrierpont
    https://www.facebook.com/csaladeskarrierpont/

Links - Outbound (nofollow)

0:

Keyword Cloud for Vasmegye.hu

idwpfm13426wpfmtemplate4 wpfmpositionbottomleftadatokkzmeghallgatst tartnbsplandscape wpfmfloatingwhwrapperdisplaynone li wpfmtootltiptitleafter wpfm13426wpfmtemplate1liwpfmactivenav spanwpfmiconblockwpfm13426wpfmtemplate6 wpfmmenuname wpfm13426wpfmtemplate7termlfrdk tematikuswpfm13426wpfmtemplate3 wpfmmenunavwpfmpositionbottomright ulspanwpfmtootltiptitleafter wpfm13426wpfmtemplate6elkszlt a restart4danube2 and orientationli wpfmtootltiptitleafter wpfm13426wpfmtemplate13natrparkokrelative kozadatkereso formgeneva sansserif paddingspan imgwpfmimageiconwpfm13426wpfmtemplate3 wpfmmenunavwpfmpositionbottomleftul lihoverimportantwpfm13426wpfmtemplate10 ulcolornemzeti park natrparkokorientationwpfmmenunav wpfmiconmenunamewrappertwpfm13426wpfmtemplate13 iphonenincsen megjelenthet esemnywpfm13426wpfmtemplate1 wpfmpositiontoprightwpfm13426wpfmtemplate3 wpfmmenunavwpfmpositiontopleft ullihover wpfmiconblockberzsenyi trkzmeghallgats 2020 oktberkulturlis12namenincsen megjelenthetularialdegc mstart a megyehzahatrozatokwpfm13426wpfmtemplate8alkalmazsokszombathely berzsenyi trbody wpswsociallinks li6wpfmmenunavwpfmpositiontopleftspanwpfmiconblockwpfmfloatingwhwrapperdisplaynoneliwpfmactivenavhovernmetwpfm13426wpfmtemplate9wpfmpositionright9 kpvrak kastlyok mzeumokbognr balzsul liwpfmtitlehidden5megyei kzgyls0px marginmarginwpfm13426wpfmtemplate6 ul15wpfmpositionbottomleftels2 wpfmfloatingwhwrapperdisplaynone portraitwpfmfloatingwhwrapperdisplaynone landscapewpfm13426wpfmtemplate1 wpfmpositionbottomleft2 wpfmfloatingwhwrapperdisplaynoneul liwpfmtitlehiddenwpfmactivenavhoverli wpfmtootltiptitleafter wpfm13426wpfmtemplate3kozadatkeresogalrik nemzetiwpfmtooltip wpfmiconblock480px and webkitmindevicepixelratioonly screenjqueryultematikus utakberzsenyiwpfmtootltiptitleafter wpfm13426wpfmtemplate7kastlyok mzeumoknyilvnossansserifwpfmmenunavwpfmpositionright ul liwpfm13426wpfmtemplate9wpfmpositiontopleftspanwpfmmenuname wpfm13426wpfmtemplate1480pxliwpfmactivenav wpfmiconblockdntshozatal lsekwpfm13426wpfmtemplate7li spanwpfmtootltiptitleafterliwpfmactivenav wpfm13426wpfmtemplate3wpfm13426wpfmtemplate1 wpfmpositionleft ulwpfmtootltiptitleafter wpfm13426wpfmtemplate2wpfm13426wpfmtemplate4 wpfmpositionleftwpfmpositionleft ul liwpfmpositionleftmegyehza szombathely berzsenyiwpswsociallinks likzadat keresbody wpswsociallinksnatrparkok gygyswpfm13426wpfmtemplate3 wpfmmenunavwpfmpositiontopleftwpfmiconblockwpfm13426wpfmtemplate4 ul liwpfm13426wpfmtemplate1 wpfmpositionleftwpfmiconblock wpfm13426wpfmtemplate1typevrakli a spanwpfmiconblockparkwpfm13426wpfmtemplate3 wpfmmenunavwpfmpositiontoprightwpfm13426wpfmtemplate7 ul liwpfmtootltiptitleaftervas megyebalzswpfm13426wpfmtemplate4 wpfmpositiontoprightwpfmpositionleft ulvas megye hivataloswpfm13426wpfmtemplate1 ul li1568px and webkitmindevicepixelratioliwpfmtitlehiddenwpfmactivenavhoverwebkitmindevicepixelratio 2 wpfmfloatingwhwrapperdisplaynonewpfm13426wpfmtemplate4 wpfmmenunav ulwpfmpositionbottomcenter ulkzrdekwpfm13426wpfmtemplate7 wpfmmenunamewpfmmenunavwpfmpositionbottomrightrelative kozadatkeresocolorffffff importantwpfmfloatingwhwrapperdisplaynone portrait mediawpfm13426wpfmtemplate3 wpfmmenunavwpfmpositionbottomrightesemnyekwpfmiconblock wpfm13426wpfmtemplate1 wpfmpositionrightwpfm13426wpfmtemplate3 wpfmmenunav ulwpfmpositiontopright ulltalkzmeghallgatsmaxdevicewidth 568pxmindevicewidth 320pxmaxdevicewidth 667pxwpfm13426wpfmtemplate3 wpfmmenunavwpfmpositionleftli a spanwpfmmenunamewpfm13426wpfmtemplate6ahover spanwpfmmenunamewpfmpositionbottomcenter ul livizsglatokmindevicewidthnemzetkzi12 a vasul lihover wpfm13426wpfmtemplate3wpfmmenunavwpfmpositionleft ul lili wpfm13426wpfmtemplate2mindevicewidth 375px0 0wpfmmenunavorientation landscape wpfmfloatingwhwrapperdisplaynonewpfmtemplate12spanwpfmiconblock wpfm13426wpfmtemplate37restart4danube projekt elsmzeumok galriklandscape wpfmfloatingwhwrapperdisplaynonecolorffffff important bodywpfmfloatingwhwrapperdisplaynone landscape mediawpfm13426wpfmtemplate1 wpfmpositiontopleft ulskvetkez esemnytovbbkzmeghallgatstmegye hivatalos honlapja4pxwpfmpositionbottomleft ulgeneva sansserifgalrik nemzeti parkwpfmtemplate13vas megyei kzgyls10px1 cmertermbenscreen and mindevicewidthsolidalkalmblnatrparkok gygys termlfrdk0px 0pxliwpfmtitlehiddenhover wpfmiconblockemaildntshozatalwpfmfloatingwhwrapperdisplaynone portraitbvebbenkatasztrfavdelmiwpfmmenunameimgwpfmimageiconwpfmpositionbottomright ulwpfmpositionright2020 oktber 12testlet ltalwpfmmenunavwpfmpositionbottomleft13els hrleveleli ahover wpfmiconblockli a spantzoltwpfmmenunavwpfmpositionbottomright ulkzadattr 1hellipwpfmmenuname wpfm13426wpfmtemplate7wpfm13426wpfmtemplate4 wpfmpositionbottomright2020 oktber 22ahover spanwpfmmenuname wpfm13426wpfmtemplate1fontkerken trawpfm13426wpfmtemplate3 wpfmmenunavwpfmpositionleft ulszervezetekspanwpfm13426cmertermbenul liwpfmactivenavwpfmtootltiptitlewpfm13426wpfmtemplate4 wpfmpositionbottomleft ulrendeletekvas megyeilandscape mediawpfmmenunavwpfmpositionbottomleft ul375px and maxdevicewidthtransparent1500 rainemzetiwpfmiconblock wpfm13426wpfmtemplate1 wpfmpositiontoprightwpfm13426wpfmtemplate12tovbb hrekkvetkezbackgroundcolorul li wpfmtootltiptitleul liwpfmactivenavhover wpfm13426wpfmtemplate3onlyli wpfmtootltiptitleafter wpfm13426wpfmtemplate12wpfmpositiontoprightwpfmmenunavwpfmpositionrightwpfm13426wpfmtemplate12 wpfmmenunavmargin 0px667pxarial helvetica genevakezdettelwpfm13426wpfmtemplate2 wpfmmenunav ulwpfmpositiontopleft ul lilapokul li wpfmtootltiptitleafter1500 rai kezdetteloktber375pxesemny nincsen megjelenthetdr bognrkezdettel kzmeghallgatst tartkltsgvetsihivatalos honlapjali spanwpfmtootltiptitlebeforewpfmpositionbottomcenterdegcbackground10azwpfm13426wpfmtemplate4 wpfmpositionbottomright ulul lihover wpfmiconblocknkormnyzatwpfmpositionbottomleft ul liwpfm13426wpfmtemplate9wpfmpositionleftwpfm13426wpfmtemplate12 wpfmmenunav ulelkszltvrak kastlyoklsekliwpfmactivenav spanwpfmiconblock wpfm13426wpfmtemplate3736pxwpfmfloatingwhwrapperdisplaynone projekt elsliwpfmtitlehiddenhovermedia onlyinlinespanwpfmtootltiptitlebeforehelvetica genevawpfmpositionright ullajosul li spanwpfmtootltiptitleafterwpfm13426wpfmtemplate3 wpfmmenunavwpfmpositionrighttermlfrdk tematikus utakesemny nincsentra ajnlatokspanwpfmtootltiptitleafterwpfm13426wpfmtemplate4 wpfmpositionleft ul0wpfmpositiontopright ul ligalrik0pxwpfmmenunavwpfmpositiontoprightszervezetiwpfm13426wpfmtemplate4 wpfmpositionright ulkpportrait wpfmfloatingwhwrapperdisplaynone landscapetrwpfmnavstrechtrigger1pxwpfm13426wpfmtemplate5portrait media onlyul liwpfmactivenavhover wpfmiconblockpark natrparkokwpfm13426wpfmtemplate22020 oktbermstralandscape media onlywpfmmenunavwpfmpositionleft ulli spanwpfmtootltiptitleafter wpfm13426wpfmtemplate6li ahover spanwpfmmenunamekozadatkereso formllamiwpfm13426wpfmtemplate4 wpfmpositiontopright ulwebkitmindevicepixelratio 3li wpfmtootltiptitleafter wpfm13426wpfmtemplate2wpfmiconblock wpfm13426wpfmtemplate1 wpfmpositionbottomrightjogszablyokliwpfmtitlehiddenszabadidnpessgliwpfmactivenavhover wpfmiconblockwpfmtootltiptitleafter wpfm13426wpfmtemplate3liwpfmactivenavhover wpfmiconblock wpfm13426wpfmtemplate1szombathely berzsenyidr bognr balzs320pxlihoverportraitbodywpfm13426wpfmtemplate1wpfmmenunav uldokumentumoktexttransform uppercasehelveticaliwpfmactivenavhover wpfm13426wpfmtemplate3kzmeghallgats 2020orientation portraitspan wpfm13426wpfmtemplate6maxdevicewidth 736pxul liwpfmtitlehiddenhovervas megyei katasztrfavdelmiscreenliwpfmactivenav spanwpfmiconblock wpfm13426wpfmtemplate4textdecorationltal alkotottwpfmmenunavwpfmpositiontopleft ulwpfmiconblock wpfm13426wpfmtemplate1 wpfmpositionleftmegyeliwpfmtitlehidden wpfmtootltiptitleafter wpfm13426wpfmtemplate7restart4danubeborder 1pxtart11important bodykt kerken trawpfmnavhover wpfmmenunamewpfm13426wpfmtemplate8wpfmpositionright320px and maxdevicewidthli wpfmtootltiptitlespanwpfmmenuname wpfm13426wpfmtemplate6wpfm13426wpfmtemplate2 wpfmmenunavmegye hivataloslandscapeiphone24 9webkitmindevicepixelratio 2wpfmtootltiptitleafter wpfm13426wpfmtemplate8wpfmpositionrightrai kezdettelwpfm13426wpfmtemplate12 wpfmmenunav wpfmiconmenunamewrapperformwpfmtootltiptitleafter wpfm13426wpfmtemplate13felptsliwpfmtitlehiddenhover wpfmiconblock wpfm13426wpfmtemplate1ahovergygys termlfrdk tematikuswpfm13426wpfmtemplate4wpfm13426wpfmtemplate1 ulul liwpfmactivenav spanwpfmiconblockwebkitmindevicepixelratiohivatalvlasztsikt kerkenbalzs lajosmawpfm13426wpfmtemplate8wpfmpositionbottomrightpadding 0pxli2drprojekt els hrlevelewpfm13426wpfmtemplate11 wpfmmenunavtematikusesemnywpfm13426wpfmtemplate1 wpfmpositiontopright ulwpfmpositionbottomrightkerkenmindevicewidth 414pxmegyehznhivatalosrtkekwpfm13426wpfmtemplate13 wpfmmenunav ulul li wpfm13426wpfmtemplate2kategrikul liwpfmtitlehidden wpfmtootltiptitleafterwpfm13426wpfmtemplate1 wpfmpositionbottomright ulfejlesztsekwpfmmenunavwpfmpositiontopright ulhrleveleicontr 1 cmertermbenkpgalriawpfmiconblock wpfm13426wpfmtemplate4utaktexttransformwpfmfloatingwhwrapperdisplaynone iphoneimportant colorffffffli spanwpfmtootltiptitlebefore wpfm13426wpfmtemplate5termlfrdkwpfm13426wpfmtemplate8wpfmpositionleftborderhelyiorientation portrait wpfmfloatingwhwrapperdisplaynonewpfmiconblock imgmaxdevicewidthli ahoverlistjatemplatevaswpfmtooltipwpfm13426wpfmtemplate9 wpfmmenunavliwpfmactivenavwpfm13426wpfmtemplate1 wpfmpositionright14oktber 22szervliwpfmtitlehidden wpfmtootltiptitleafterwpfm13426wpfmtemplate9wpfmpositiontoprightarial helveticaurlahover wpfmiconblock wpfm13426wpfmtemplate4berzsenyi tr 1wpfmmenunavwpfmpositionright ulkeresrai kezdettel kzmeghallgatstmegyei katasztrfavdelmimzeumokwpfmiconmenunamewrapper spanwpfmmenunameportrait wpfmfloatingwhwrapperdisplaynonetestletwpfm13426wpfmtemplate3 wpfmmenunavwpfmpositionbottomleft ulmegyei rtktrnkormnyzat 2020wpfm13426wpfmtemplate9wpfmpositionbottomleftahover wpfmiconblock24 9 kpsansserif paddingwpfm13426wpfmtemplate10 wpfmtooltipwpfmmenunavwpfmpositionleftwpfm13426wpfmtemplate4 ul736px and webkitmindevicepixelratiocolorffffffbognr balzs lajostitlertkek vrak kastlyokul li ahoverpark natrparkok gygyskvetkez esemny nincsenlihover wpfmiconblock wpfm13426wpfmtemplate1wpfmpositionright ul liul liwpfmtitlehiddenwpfmactivenavhover wpfmiconblock3wpfm13426wpfmtemplate6 wpfmmenunamegenevakastlyok mzeumok galrikul liwpfmactivenavhoversport667px and webkitmindevicepixelratio12px arial helveticawpfm13426wpfmtemplate5 wpfmmenunavwpfm13426wpfmtemplate8wpfmpositiontopleftmenuhelvetica geneva sansserifktmegjelenthetnlkl568pxrtkek vrakspanwpfmmenuname wpfm13426wpfmtemplate3bognrprojektekwpfmmenunav a wpfmiconblockwpfm13426wpfmtemplate13 wpfmmenunav414px and maxdevicewidthhonlapjapadding414pxwpfm13426wpfmtemplate11 wpfmmenunav ul2019 2019megjelenthet esemnykezdettel kzmeghallgatst23arestart4danube projekt0px margin 0pxspanwpfmmenuname wpfm13426wpfmtemplate3 wpfmmenunavwpswsociallinksegybspanwpfmimageiconblockkzrdek adatokliwpfmtitlehiddenwpfmactivenavhover wpfmiconblockaz oktberimgimportant body wpswsociallinkswpfm13426wpfmtemplate4 wpfmpositiontopleftpositionpadding 0px marginspannamewpfmmenunameafterszombathelyromaul liwpfmactivenav wpfm13426wpfmtemplate3socialiconturizmuswpfmtootltiptitlebeforewpfmmenunav ul liwpfmactivenavterleti vlasztsiwpfm13426wpfmtemplate3lihover wpfm13426wpfmtemplate3wpfmmenunav ul liwpfm13426wpfmtemplate10portrait and landscapewpfm13426wpfmtemplate3 wpfmmenunavwpfmpositionright ulkzgylsajnlatokrtktrwpfm13426wpfmtemplate9wpfmpositionbottomright ul lioktber 12kastlyokwpfmmenunavwpfmpositionbottomright ul liposition relative kozadatkeresohivatalvezetnkormnyzat 2020 oktberwpfm13426wpfmtemplate3 wpfmmenunavwpfmpositiontopright ulgygys termlfrdknyilvnos kiadvnyok8spanwpfmiconblock wpfm13426wpfmtemplate4oktber 23a alkalmblposition relativepadding 4pxellenrzsekul likerken tra ajnlatokwpfm13426wpfmtemplate4 wpfmmenunavwpfmnavhover12px arialrelativewpfmpositiontopleft ulheightwpfmiconmenunamewrapperimportant colorffffff importantnincsenmzeumok galrik nemzeti4portrait media12pxwpfm13426wpfmtemplate1 wpfmpositiontopleftmediamegyehza szombathely23a alkalmblul li spanwpfmtootltiptitlebeforemaxdevicewidth 480pxspanwpfmmenunamewpfmnavstrechtrigger spanraioktber 23a portraitwpfmmenunavwpfmpositionbottomleft ul liwpfm13426wpfmtemplate8 wpfmmenunavvasitestlet ltal alkotottprojektorientation landscapegygyskltsgvetsi szervekwpfm13426wpfmtemplate1 wpfmpositionbottomleft ulmedia only screen2pxterletiwpfmtootltiptitleafter wpfm13426wpfmtemplate1wpfmmenunav wpfmiconmenunamewrapper spanwpfmmenunameli wpfmtootltiptitleafterli wpfmtootltiptitleafter wpfm13426wpfmtemplate4wpfmtootltiptitleafter wpfm13426wpfmtemplate12wpfm13426wpfmtemplate8wpfmpositionbottomleftwpfm13426wpfmtemplate8wpfmpositiontoprightwpfm13426wpfmtemplate7 ulwpfm13426wpfmtemplate4 wpfmpositiontopleft ulwpfm13426wpfmtemplate3 wpfmmenunavwpfm13426wpfmtemplate13 wpfmmenunav wpfmiconmenunamewrapperwpfmpositiontopleftvas megyei rtktrnemzeti parkmegyehzaspanwpfmtootltiptitlebefore wpfm13426wpfmtemplate5wpfmtootltiptitleafter wpfm13426wpfmtemplate4ul liwpfmtitlehiddenhover wpfmiconblockwpfmiconblock wpfm13426wpfmtemplate1 wpfmpositionbottomleftuppercasewpfm13426wpfmtemplate11widthwpfm13426wpfmtemplate5 wpfmmenunav ulmegyei9hrekszervekwpfm13426wpfmtemplate4 wpfmpositionrightdefaultalkotottwpfm13426wpfmtemplate1 wpfmpositionright ulkiadvnyokwpfm13426wpfmtemplate1 wpfmpositionbottomrightwpfm13426wpfmtemplate9wpfmpositionbottomrightwpfmiconblock wpfm13426wpfmtemplate1 wpfmpositiontopleft

Longtail Keyword Density for Vasmegye.hu

KeywordsOccurences
ul li wpfm-tootltip-titleafter49
wpfm-menu-nav ul li34
ul li ahover16
ul liwpfm-active-nav spanwpfm-icon-block13
media only screen12
screen and min-device-width12
li a spanwpfm-menu-name12
wpfm-position-top-left ul li11
wpfm-position-bottom-left ul li10
wpfm-position-top-right ul li10
wpfm-13426wpfm-template-5 wpfm-menu-nav ul10
body wpsw-social-links li10
wpfm-position-bottom-right ul li9
li wpfm-tootltip-titleafter wpfm-13426wpfm-template-39
wpfm-13426wpfm-template-11 wpfm-menu-nav ul8
ul li wpfm-tootltip-title8
wpfm-position-left ul li8
landscape media only8
wpfm-menu-nav ul liwpfm-active-nav8
wpfm-position-right ul li7
wpfm-menu-navwpfm-position-right ul li7
ul liwpfm-active-nav wpfm-13426wpfm-template-37
li a span7
li ahover wpfm-icon-block7
li a spanwpfm-icon-block6
ahover wpfm-icon-block wpfm-13426wpfm-template-46
ul liwpfm-title-hiddenhover wpfm-icon-block6
wpfm-menu-navwpfm-position-left ul li6
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-right ul6
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-left ul6
wpfm-menu-nav a wpfm-icon-block6
liwpfm-active-nav spanwpfm-icon-block wpfm-13426wpfm-template-36
2 and orientation6
ul liwpfm-title-hidden wpfm-tootltip-titleafter6
ul lihover wpfm-icon-block6
320px and max-device-width6
li wpfm-tootltip-titleafter wpfm-13426wpfm-template-26
ul li spanwpfm-tootltip-titleafter6
ul li spanwpfm-tootltip-titlebefore6
ul liwpfm-active-navhover wpfm-icon-block6
liwpfm-active-navhover wpfm-icon-block wpfm-13426wpfm-template-16
li wpfm-tootltip-titleafter wpfm-13426wpfm-template-46
testlet ltal alkotott6
vas megyei kzgyls6
liwpfm-title-hiddenhover wpfm-icon-block wpfm-13426wpfm-template-16
wpfm-13426wpfm-template-1 wpfm-position-bottom-left ul5
wpfm-13426wpfm-template-1 wpfm-position-left ul5
ul li wpfm-13426wpfm-template-25
li ahover spanwpfm-menu-name5
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-top-left ul5
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-bottom-left ul5
ul liwpfm-active-navhover wpfm-13426wpfm-template-35
wpfm-13426wpfm-template-4 ul li5
liwpfm-active-nav spanwpfm-icon-block wpfm-13426wpfm-template-45
wpfm-13426wpfm-template-2 wpfm-menu-nav ul5
wpfm-13426wpfm-template-3 wpfm-menu-nav ul5
li wpfm-tootltip-titleafter wpfm-13426wpfm-template-125
li wpfm-tootltip-titleafter wpfm-13426wpfm-template-135
wpfm-13426wpfm-template-1 wpfm-position-top-left ul5
wpfm-13426wpfm-template-7 ul li5
lihover wpfm-icon-block wpfm-13426wpfm-template-15
wpfm-13426wpfm-template-1 ul li5
wpfm-13426wpfm-template-1 wpfm-position-top-right ul4
position relative kozadatkereso4
wpfm-13426wpfm-template-1 wpfm-position-bottom-right ul4
2020 oktber 224
24 9 kp4
0px margin 0px4
padding 0px margin4
geneva sans-serif padding4
helvetica geneva sans-serif4
wpfm-menu-nav wpfm-icon-menu-name-wrapper spanwpfm-menu-name4
arial helvetica geneva4
relative kozadatkereso form4
li wpfm-tootltip-titleafter wpfm-13426wpfm-template-14
12px arial helvetica4
kzmeghallgats 2020 oktber4
wpfm-floating-wh-wrapperdisplaynone portrait media4
portrait media only4
orientation portrait wpfm-floating-wh-wrapperdisplaynone4
portrait wpfm-floating-wh-wrapperdisplaynone landscape4
wpfm-floating-wh-wrapperdisplaynone landscape media4
orientation landscape wpfm-floating-wh-wrapperdisplaynone4
li spanwpfm-tootltip-titlebefore wpfm-13426wpfm-template-54
li spanwpfm-tootltip-titleafter wpfm-13426wpfm-template-64
liwpfm-title-hidden wpfm-tootltip-titleafter wpfm-13426wpfm-template-74
vas megyei katasztrfavdelmi4
oktber 23-a alkalmbl4
wpfm-icon-block wpfm-13426wpfm-template-1 wpfm-position-top-left4
portrait and landscape4
wpfm-icon-block wpfm-13426wpfm-template-1 wpfm-position-bottom-left4
wpfm-icon-block wpfm-13426wpfm-template-1 wpfm-position-left4
megye hivatalos honlapja4
vas megye hivatalos4
important body wpsw-social-links4
colorffffff important body4
2020 oktber 124
important colorffffff important4
tr 1 cmertermben4
berzsenyi tr 14
szombathely berzsenyi tr4
megyehza szombathely berzsenyi4
tart a megyehza4
kezdettel kzmeghallgatst tart4
rai kezdettel kzmeghallgatst4
1500 rai kezdettel4
nkormnyzat 2020 oktber4
12 a vas4
wpfm-13426wpfm-template-12 wpfm-menu-nav ul4
wpfm-13426wpfm-template-1 wpfm-position-right ul4
568px and -webkit-min-device-pixel-ratio3
375px and max-device-width3
667px and -webkit-min-device-pixel-ratio3
wpfm-13426wpfm-template-4 wpfm-position-top-left ul3
wpfm-floating-wh-wrapperdisplaynone ----------- iphone3
414px and max-device-width3
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-top-right ul3
landscape wpfm-floating-wh-wrapperdisplaynone -----------3
wpfm-13426wpfm-template-4 wpfm-position-bottom-left ul3
wpfm-position-bottom-center ul li3
ul liwpfm-title-hiddenwpfm-active-navhover wpfm-icon-block3
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-bottom-right ul3
-webkit-min-device-pixel-ratio 2 wpfm-floating-wh-wrapperdisplaynone3
480px and -webkit-min-device-pixel-ratio3
2 wpfm-floating-wh-wrapperdisplaynone portrait3
rtkek vrak kastlyok3
wpfm-13426wpfm-template-4 wpfm-position-left ul3
kt kerken tra3
elkszlt a restart4danube3
nincsen megjelenthet esemny3
esemny nincsen megjelenthet3
kvetkez esemny nincsen3
vas megyei rtktr3
kerken tra ajnlatok3
termlfrdk tematikus utak3
projekt els hrlevele3
gygy-s termlfrdk tematikus3
natrparkok gygy-s termlfrdk3
park natrparkok gygy-s3
nemzeti park natrparkok3
galrik nemzeti park3
mzeumok galrik nemzeti3
kastlyok mzeumok galrik3
restart4danube projekt els3
dr bognr balzs3
wpfm-13426wpfm-template-4 wpfm-position-bottom-right ul3
wpfm-13426wpfm-template-6 wpfm-menu-name wpfm-13426wpfm-template-73
wpfm-13426wpfm-template-4 wpfm-position-top-right ul3
wpfm-13426wpfm-template-4 wpfm-position-right ul3
wpfm-13426wpfm-template-4 wpfm-menu-nav ul3
wpfm-13426wpfm-template-13 wpfm-menu-nav wpfm-icon-menu-name-wrapper3
wpfm-13426wpfm-template-12 wpfm-menu-nav wpfm-icon-menu-name-wrapper3
spanwpfm-menu-name wpfm-13426wpfm-template-3 wpfm-menu-nav3
ahover spanwpfm-menu-name wpfm-13426wpfm-template-13
wpfm-13426wpfm-template-13 wpfm-menu-nav ul3
bognr balzs lajos3
vrak kastlyok mzeumok3
ul lihover wpfm-13426wpfm-template-33
wpfm-menu-navwpfm-position-bottom-right ul li3
wpfm-menu-navwpfm-position-bottom-left ul li3
wpfm-icon-block wpfm-13426wpfm-template-1 wpfm-position-bottom-right3
wpfm-icon-block wpfm-13426wpfm-template-1 wpfm-position-top-right3
wpfm-icon-block wpfm-13426wpfm-template-1 wpfm-position-right3
736px and -webkit-min-device-pixel-ratio3
ul li139
li wpfm-tootltip-titleafter49
wpfm-menu-nav ul44
ul liwpfm-active-nav31
2020 oktber22
vas megyei22
wpfm-icon-block wpfm-13426wpfm-template-121
wpfm-position-top-left ul17
wpfm-position-bottom-left ul16
li ahover16
wpfm-position-top-right ul15
kozadatkereso form14
wpfm-position-left ul14
wpfm-position-bottom-right ul14
liwpfm-active-nav spanwpfm-icon-block13
margin 0px12
ul liwpfm-active-navhover12
wpfm-position-right ul12
media only12
only screen12
vas megye12
wpfm-menu-navwpfm-position-right ul11
wpfm-menu-navwpfm-position-left ul10
spanwpfm-icon-block wpfm-13426wpfm-template-310
body wpsw-social-links10
wpsw-social-links li10
wpfm-13426wpfm-template-5 wpfm-menu-nav10
ul lihover10
-webkit-min-device-pixel-ratio 29
wpfm-tootltip-titleafter wpfm-13426wpfm-template-39
wpfm-menu-nav wpfm-icon-menu-name-wrapper8
wpfm-13426wpfm-template-9 wpfm-menu-nav8
megyei kzgyls8
landscape media8
position relative8
li wpfm-tootltip-title8
degc ms8
wpfm-13426wpfm-template-11 wpfm-menu-nav8
liwpfm-active-nav wpfm-13426wpfm-template-37
wpfm-13426wpfm-template-12 wpfm-menu-nav7
kzrdek adatok7
wpfm-menu-navwpfm-position-bottom-left ul7
ahover wpfm-icon-block7
wpfm-13426wpfm-template-1 ul7
liwpfm-title-hiddenhover wpfm-icon-block6
testlet ltal6
kt kerken6
liwpfm-active-navhover wpfm-icon-block6
wpfm-menu-navwpfm-position-top-left ul6
ul liwpfm-title-hiddenhover6
wpfm-menu-navwpfm-position-bottom-right ul6
wpfm-icon-block wpfm-13426wpfm-template-46
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-left6
lihover wpfm-icon-block6
min-device-width 320px6
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-right6
wpfm-tootltip-titleafter wpfm-13426wpfm-template-46
wpfm-13426wpfm-template-7 ul6
wpfm-13426wpfm-template-8 wpfm-menu-nav6
ltal alkotott6
li spanwpfm-tootltip-titlebefore6
wpfm-tootltip-titleafter wpfm-13426wpfm-template-26
arial helvetica6
0 06
li spanwpfm-tootltip-titleafter6
wpfm-navhover wpfm-menu-name6
ul liwpfm-title-hidden6
liwpfm-title-hidden wpfm-tootltip-titleafter6
wpfm-13426wpfm-template-13 wpfm-menu-nav6
spanwpfm-menu-name wpfm-13426wpfm-template-35
wpfm-13426wpfm-template-1 wpfm-position-top-left5
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-bottom-left5
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-top-left5
wpfm-tootltip-titleafter wpfm-13426wpfm-template-125
wpfm-tootltip-titleafter wpfm-13426wpfm-template-75
spanwpfm-icon-block wpfm-13426wpfm-template-45
wpfm-menu-navwpfm-position-top-right ul5
wpfm-13426wpfm-template-3 wpfm-menu-nav5
wpfm-icon-block img5
wpfm-tootltip-titleafter wpfm-13426wpfm-template-135
liwpfm-active-navhover wpfm-13426wpfm-template-35
ahover spanwpfm-menu-name5
wpfm-13426wpfm-template-1 wpfm-position-bottom-left5
wpfm-13426wpfm-template-2 wpfm-menu-nav5
wpfm-13426wpfm-template-1 wpfm-position-left5
wpfm-13426wpfm-template-4 ul5
li wpfm-13426wpfm-template-25
szombathely berzsenyi5
tr 15
wpfm-13426wpfm-template-1 wpfm-position-right4
wpfm-icon-menu-name-wrapper spanwpfm-menu-name4
border 1px4
padding 4px4
wpfm-tooltip wpfm-icon-block4
helvetica geneva4
geneva sans-serif4
wpfm-tootltip-titleafter wpfm-13426wpfm-template-14
sans-serif padding4
padding 0px4
0px margin4
0px 0px4
24 94
9 kp4
hivatalos honlapja4
kzadat keres4
12px arial4
wpfm-nav-strech-trigger span4
nyilvnos kiadvnyok4
kltsgvetsi szervek4
spanwpfm-tootltip-titlebefore wpfm-13426wpfm-template-54
spanwpfm-tootltip-titleafter wpfm-13426wpfm-template-64
terleti vlasztsi4
liwpfm-active-nav wpfm-icon-block4
wpfm-floating-wh-wrapperdisplaynone portrait4
portrait media4
orientation portrait4
portrait wpfm-floating-wh-wrapperdisplaynone4
wpfm-floating-wh-wrapperdisplaynone landscape4
orientation landscape4
landscape wpfm-floating-wh-wrapperdisplaynone4
2019 20194
relative kozadatkereso4
oktber 224
wpfm-13426wpfm-template-1 wpfm-position-bottom-right4
berzsenyi tr4
megyehza szombathely4
kzmeghallgatst tart4
dntshozatal lsek4
kezdettel kzmeghallgatst4
rai kezdettel4
1500 rai4
nkormnyzat 20204
kzmeghallgats 20204
important colorffffff4
colorffffff important4
important body4
tovbb hrek4
oktber 124
megye hivatalos4
23-a alkalmbl4
oktber 23-a4
megyei katasztrfavdelmi4
wpfm-13426wpfm-template-10 ul4
1 cmertermben4
wpfm-13426wpfm-template-1 wpfm-position-top-right4
----------- portrait3
nemzeti park3
liwpfm-title-hiddenwpfm-active-navhover wpfm-icon-block3
tematikus utak3
termlfrdk tematikus3
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-top-right3
max-device-width 736px3
wpfm-13426wpfm-template-3 wpfm-menu-navwpfm-position-bottom-right3
gygy-s termlfrdk3
natrparkok gygy-s3
park natrparkok3
min-device-width 414px3
max-device-width 667px3
rtkek vrak3
galrik nemzeti3
wpfm-floating-wh-wrapperdisplaynone -----------3
kastlyok mzeumok3
----------- iphone3
min-device-width 375px3
2 wpfm-floating-wh-wrapperdisplaynone3
max-device-width 568px3
vrak kastlyok3
max-device-width 480px3
ul liwpfm-title-hiddenwpfm-active-navhover3
mzeumok galrik3
megyei rtktr3
kerken tra3
span imgwpfm-image-icon3
wpfm-13426wpfm-template-6 wpfm-menu-name3
wpfm-menu-name wpfm-13426wpfm-template-73
az oktber3
spanwpfm-menu-name wpfm-13426wpfm-template-13
restart4danube projekt3
projekt els3
els hrlevele3
spanwpfm-menu-name wpfm-13426wpfm-template-63
wpfm-13426wpfm-template-7 wpfm-menu-name3
lihover wpfm-13426wpfm-template-33
dr bognr3
wpfm-13426wpfm-template-4 wpfm-menu-nav3
wpfm-13426wpfm-template-10 wpfm-tooltip3
bognr balzs3
balzs lajos3
tra ajnlatok3
esemny nincsen3
wpfm-position-bottom-center ul3
wpfm-13426wpfm-template-4 wpfm-position-bottom-left3
wpfm-13426wpfm-template-4 wpfm-position-top-left3
wpfm-13426wpfm-template-4 wpfm-position-left3
span wpfm-13426wpfm-template-63
kvetkez esemny3
nincsen megjelenthet3
wpfm-13426wpfm-template-6 ul3
megjelenthet esemny3
wpfm-13426wpfm-template-4 wpfm-position-bottom-right3
wpfm-13426wpfm-template-4 wpfm-position-top-right3
wpfm-13426wpfm-template-4 wpfm-position-right3
text-transform uppercase3
wpfm-tootltip-titleafter wpfm-13426wpfm-template-8wpfm-position-right3
-webkit-min-device-pixel-ratio 33
ul213
li151
wpfm-tootltip-titleafter73
wpfm-menu-nav67
wpfm-icon-block47
wpfm-13426wpfm-template-344
wpfm-13426wpfm-template-140
vas37
liwpfm-active-nav34
oktber32
027
wpfm-13426wpfm-template-426
spanwpfm-menu-name25
megyei25
0px22
spanwpfm-icon-block20
adatok19
wpfm-13426wpfm-template-519
kozadatkereso18
wpfm-13426wpfm-template-218
ahover18
wpfm-13426wpfm-template-617
wpfm-menu-name17
wpfm-13426wpfm-template-717
wpfm-position-top-left17
span16
wpfm-position-bottom-left16
wpfm-13426wpfm-template-1115
margin15
115
wpfm-position-top-right15
form14
wpfm-position-bottom-right14
megye14
padding14
wpfm-position-left14
color13
wpfm-tootltip-title13
213
wpfm-tootltip-titlebefore13
egyb13
wpfm-floating-wh-wrapperdisplaynone12
az12
kzgyls12
background12
wpfm-13426wpfm-template-1212
max-device-width12
liwpfm-active-navhover12
-webkit-min-device-pixel-ratio12
min-device-width12
portrait12
landscape12
media12
screen12
only12
wpfm-position-right12
312
wpfm-13426wpfm-template-1311
411
wpfm-menu-navwpfm-position-right11
kp10
wpsw-social-links10
important10
510
nkormnyzat10
wpfm-13426wpfm-template-810
wpfm-menu-navwpfm-position-left10
body10
lihover10
font9
s9
wpfm-13426wpfm-template-99
wpfm-13426wpfm-template-109
wpfm-icon-menu-name-wrapper8
orientation8
relative8
terleti8
vasi8
ms8
ltal8
position8
degc8
4px8
hrek7
kt7
wpfm-menu-navwpfm-position-bottom-left7
wpfm-tooltip7
kzrdek7
nemzeti7
projektek7
kiadvnyok7
hatrozatok6
-----------6
320px6
dokumentumok6
liwpfm-title-hiddenhover6
liwpfm-title-hidden6
spanwpfm-tootltip-titleafter6
spanwpfm-tootltip-titlebefore6
66
img6
wpfm-navhover6
szombathely6
alkalmbl6
keres6
solid6
arial6
76
alkotott6
testlet6
wpfm-menu-navwpfm-position-top-left6
background-color6
kerken6
12px6
helvetica6
sans-serif6
wpfm-menu-navwpfm-position-bottom-right6
szervezeti6
esemny6
wpfm-menu-navwpfm-position-top-right5
title5
tr5
berzsenyi5
tovbb5
85
template5
dr5
katasztrfavdelmi5
projekt5
border5
bvebben5
esemnyek5
kvetkez5
llami4
kltsgvetsi4
szervek4
lapok4
szerv4
jogszablyok4
nyilvnos4
listja4
sport4
vizsglatok4
wpfm-13426wpfm-template-8wpfm-position-bottom-right4
kzadat4
10px4
94
lsek4
szabadid4
wpfm-13426wpfm-template-8wpfm-position-top-right4
rendeletek4
fejlesztsek4
wpfm-13426wpfm-template-8wpfm-position-right4
imgwpfm-image-icon4
transparent4
turizmus4
wpfm-nav-strech-trigger4
vlasztsi4
wpfm-134264
kategrik4
felpts4
hivatalvezet4
szervezetek4
helyi4
nemzetkzi4
ma4
1px4
104
ellenrzsek4
width4
hellip4
type4
23-a4
tzolt4
kzmeghallgats4
megyehzn4
114
icon4
kezdettel4
kzmeghallgatst4
tart4
megyehza4
124
134
cmertermben4
rai4
roma4
jqueryul4
social-icon4
text-decoration4
colorffffff4
2px4
nmet4
geneva4
dntshozatal4
hivatalos4
honlapja4
kpgalria4
vrak3
kastlyok3
wpfm-13426wpfm-template-8wpfm-position-bottom-left3
iphone3
wpfm-13426wpfm-template-8wpfm-position-top-left3
480px3
mzeumok3
wpfm-13426wpfm-template-8wpfm-position-left3
galrik3
name3
rtkek3
143
wpfm-position-bottom-center3
wpfm-template-123
wpfm-template-133
736px3
liwpfm-title-hiddenwpfm-active-navhover3
spanwpfm-image-icon-block3
414px3
667px3
375px3
hivatal3
568px3
npessg3
elkszlt3
nincsen3
park3
inline3
kulturlis3
text-transform3
uppercase3
default3
email3
nbsp3
153
megjelenthet3
t3
lajos3
balzs3
bognr3
nlkl3
hrlevele3
els3
id3
restart4danube3
natrparkok3
termlfrdk3
height3
gygy-s3
wpfm-13426wpfm-template-9wpfm-position-bottom-right3
wpfm-13426wpfm-template-9wpfm-position-top-right3
wpfm-13426wpfm-template-9wpfm-position-right3
wpfm-13426wpfm-template-9wpfm-position-bottom-left3
wpfm-13426wpfm-template-9wpfm-position-top-left3
wpfm-13426wpfm-template-9wpfm-position-left3
menu3
tematikus3
utak3
tra3
ajnlatok3
alkalmazsok3
spannamewpfm-menu-nameafter3
rtktr3
url3

Vasmegye.hu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Vasmedia.link
Web Hosting from HostPapa
Vasmefidar.com
???? ?????
Vasmegye.hu
Főoldal - Vas megye hivatalos honlapja
Vasmer.info
Vasmer – Rise Provides A Comprehensive Spectrum Of Records Management Services
Vasmester.hu
Eladó domain név: *** vasmester.hu *** [unidomain]
Vasmex.com
HugeDomains.com - Shop for over 300,000 Premium Domains

Recently Updated Websites

Pettybetty716.com 2 seconds ago.Bokut.in 2 seconds ago.Indianlarryforever.com 3 seconds ago.Rpmbd.com 3 seconds ago.Sweetsandhearts.com 3 seconds ago.Avlegalservices.com 4 seconds ago.Atsenv.com 4 seconds ago.Pensler.com 4 seconds ago.Houstonpaintpros.com 5 seconds ago.Cokelight.at 5 seconds ago.Cherylgrosso.com 6 seconds ago.Mfainteriors.com 7 seconds ago.Musically.info 7 seconds ago.Tmottradio.com 7 seconds ago.Viralurl.com 7 seconds ago.Chungyanshih.com 8 seconds ago.Super62.com 8 seconds ago.Infogateway.org 8 seconds ago.Danskfranskordbog.dk 8 seconds ago.Catherinelarouchemasso.com 9 seconds ago.Minamericanshepherd.com 9 seconds ago.Museohistoriale.org 9 seconds ago.Bamajam2012.com 10 seconds ago.Legalgreener.com 10 seconds ago.Greedyhealthplans.com 11 seconds ago.Tasaroobat.com 12 seconds ago.Ninkihikaku.com 12 seconds ago.Flxconstruction.com 12 seconds ago.Colbernrd.org 12 seconds ago.9fail.com 13 seconds ago.