BizFly Cloud - Cung cấp dịch vụ điện toán đám mây tốt nhất tại Việt Nam

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 53,903
Estimated Worth: $402,480

BizFly Cloud - Cung cấp các dịch vụ trên nền tảng điện toán đám mây như Cloud Server, CDN giá rẻ, miễn phí dùng thử tốt nhất tại Việt Nam



Domain summary

Last updated
2020-10-21
Domain label
vccloud
Domain extension
vn
Global Traffic Rank
53,903
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$402,480
Estimated daily income
$559
Estimated monthly income
$17,003

Frequently Asked Questions (FAQ)

Q: When was Vccloud.vn registered?
A: Vccloud.vn was registered 8 months, 3 days, 8 hours, 45 minutes, 23 seconds ago on Wednesday, October 21, 2020.
Q: When was the WHOIS for Vccloud.vn last updated?
A: The WHOIS entry was last updated 8 months, 3 days, 8 hours, 45 minutes, 23 seconds ago on Wednesday, October 21, 2020.
Q: Who is the registrar for the Vccloud.vn domain?
A: The domain has been registered at .
Q: What is the traffic rank for Vccloud.vn?
A: Vccloud.vn ranks 53,903 globally on Alexa. Vccloud.vn has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Vccloud.vn each day?
A: Vccloud.vn receives approximately 46,606 visitors and 279,636 page impressions per day.
Q: What IP address does Vccloud.vn resolve to?
A: Vccloud.vn resolves to the IPv4 address 123.31.11.119.
Q: In what country are Vccloud.vn servers located in?
A: Vccloud.vn has servers located in the Vietnam.
Q: What webserver software does Vccloud.vn use?
A: Vccloud.vn is powered by Nginx webserver.
Q: Who hosts Vccloud.vn?
A: Vccloud.vn is hosted by VIETNAM POSTS AND TELECOMMUNICATIONS GROUP in Vietnam.
Q: How much is Vccloud.vn worth?
A: Vccloud.vn has an estimated worth of $402,480. An average daily income of approximately $559, which is roughly $17,003 per month.

Vccloud.vn Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Vccloud.vn Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Vccloud.vn

H1 Headings

1 :
  1. BizFly Cloud Dịch vụ điện toán đám mây tốt nhất tại Việt Nam

H2 Headings

5 :
  1. Dịch vụ của chúng tôi
  2. Lợi ích khi lựa chọn BizFly Cloud
  3. Đăng ký trải nghiệm dịch vụ miễn phí
  4. 83000+ Khách hàng đăng ký và 3000+ Doanh nghiệp tin dùng
  5. Kiểm tra tốc độ kết nối đến hệ thống BizFly Cloud

H3 Headings

21 :
  1. BizFly Cloud Server
  2. BizFly CDN
  3. BizFly Business Email
  4. BizFly Load Balancer
  5. BizFly Simple Storage
  6. BizFly Pre-built application
  7. BizFly VPN
  8. BizFly Container Registry
  9. BizFly Call Center
  10. Hạ tầng mạnh mẽ
  11. Bảo vệ dữ liệu
  12. Tối ưu chi phí
  13. Khẳng định thương hiệu
  14. Chuyên gia kinh nghiệm
  15. Hỗ trợ 24/7
  16. Anh Nguyễn Thanh Hải
  17. Anh Nguyễn Mạnh
  18. Anh Đặng Thái Sơn
  19. Sản phẩm
  20. Về BIZFLY CLOUD
  21. Tech Blog

H4 Headings

7 :
  1. Soha.vn
  2. Enbac.com
  3. Cafef.vn
  4. Trụ sở chính:
  5. Chi nhánh TP.Hồ Chí Minh:
  6. Chi nhánh TP.Đà Nẵng:
  7. Chi nhánh TP.Hải Phòng:

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

68 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-62110417-1

Links - Internal

47:

Links - Internal (nofollow)

0:

Links - Outbound

38:

Links - Outbound (nofollow)

3:

Keyword Cloud for Vccloud.vn

bizfly callbizfly cloud servercontainer registrytiprebuilt applicationcngroundtrstrokelinejoin round strokewidthcallstrokelinecap roundhistrokelinecapdoanh nghipkt nitm hiubngcc ng dngcurrentpath000 strokelinecap roundround strokewidththlngtstrokebizfly cloudphcenteriucc ng7302 8888tinbizflymym boclbizfly call centercuv ncloud servergipthanhhotlinedategettimeloadcpngemailstrokelinejoin roundvnserverstrokewidthbstroke 000dng thbizfly loadchnhdngng dngfill none strokenbspwindowischeckpagethngnone strokecho doanhcung cpngi2ngybalancervmnhchtround strokewidth 2pxeif windowischeckpagekhchnewh tnghnscriptchbizfly load balancerti ucloudstoragen nhchoprebuiltanhnguynqunbizfly business emailmin phbizfly simple storage13nibizfly prebuiltfunctionginbizfly containerhiu thm000 strokelinecaphsimpletpcdnbusinessstruyngidchnhnhbizfly container registrychi phjsbo mtstrokelinecap round strokelinejointhiud liuround strokelinejoin roundtonsnbizfly businessnghipstrokelinejoinbusiness emailnghimdksimple storagedocument scripttng5caxuntargettm hiu thmifround strokelinejoinsettimeoutfunctionvpnkimchngdocumentfillcontainercungminregistrythanh xunngay2pxhiuliung keventtimeoutbnthm bizflycho doanh nghipdungkhstrokewidth 2pxtmmnh muhnhphngth bizflybo000mthiu thm bizflycu hnhttchi nhnhcall centerviccbizfly simplenone stroke 0000vargiiload balancerhngbng ginhth trh thngbizfly vpnnonekinhkhch hngnhktbizfly prebuilt applicationchuyndoanhbng gi bizflys dngkhichikhngreadyfntt nhtgi bizflydch vbizfly cdnnngthmstroke 000 strokelinecapchng ti4applicationndng th bizflyfill none

Longtail Keyword Density for Vccloud.vn

KeywordsOccurences
tm hiu thm9
hiu thm bizfly8
bng gi bizfly7
bizfly cloud server7
round stroke-width 2px6
fill none stroke6
stroke-linejoin round stroke-width6
round stroke-linejoin round6
stroke-linecap round stroke-linejoin6
000 stroke-linecap round6
stroke 000 stroke-linecap6
none stroke 0006
bizfly simple storage4
bizfly pre-built application3
cho doanh nghip3
bizfly business email3
bizfly load balancer3
dng th bizfly3
bizfly call center3
bizfly container registry3
cc ng dng3
bizfly cloud15
dch v10
hiu thm9
tm hiu9
khch hng9
thm bizfly8
cloud server8
bng gi7
gi bizfly7
stroke-linecap round6
none stroke6
stroke 0006
000 stroke-linecap6
round stroke-width6
round stroke-linejoin6
stroke-linejoin round6
ng k6
stroke-width 2px6
fill none6
h thng5
dng th5
h tr5
bizfly cdn5
doanh nghip4
bizfly simple4
ti u4
simple storage4
min ph4
bo mt4
ng dng3
cc ng3
v n3
kt ni3
s dng3
thanh xun3
n nh3
chi nhnh3
if windowischeckpage3
m bo3
chng ti3
cho doanh3
container registry3
bizfly business3
business email3
bizfly load3
load balancer3
bizfly pre-built3
pre-built application3
bizfly vpn3
bizfly container3
bizfly call3
d liu3
call center3
7302 88883
th bizfly3
tt nht3
h tng3
mnh m3
chi ph3
cu hnh3
cung cp3
document script3
bizfly50
v33
ti23
dng20
ng17
cloud17
h16
function12
round12
s11
hiu11
if11
hng11
bo10
dch10
m10
ch10
ph10
cho10
gi10
tng10
d9
server9
bng9
ton9
k9
tr9
thm9
khch9
cc9
c9
tm9
n8
ca8
thng8
cdn8
var7
thanh7
lng7
chi7
l7
0006
2px6
stroke-width6
stroke-linejoin6
stroke-linecap6
khng6
stroke6
mt6
fill6
sn6
ni6
cu6
nh6
none6
khi6
nht6
currentpath6
u6
th6
tt6
tin5
cng5
vi5
liu5
gii5
new5
tp5
nghip5
doanh5
phng5
ngi5
email5
cp5
chnh4
vpn4
container4
b4
kt4
nguyn4
registry4
t4
target4
nng4
min4
center4
chng4
mnh4
storage4
04
ngy4
chuyn4
nghim4
gip4
simple4
document3
script3
dategettime3
hi3
13
anh3
e3
readyfn3
windowischeckpage3
nhnh3
qun3
settimeoutfunction3
23
timeout3
event3
xun3
dung3
kinh3
nbsp3
business3
load3
balancer3
pre-built3
application3
call3
thiu3
hotline3
33
43
ngay3
53
vn3
hnh3
cung3
iu3
truyn3
cht3
hn3
bn3
y3
kh3
gin3
kim3
js3

Who hosts Vccloud.vn?

Vccloud.vn Hosting Provider Information

Hosted IP Address:123.31.11.119
Hosted Hostname:static.vnpt.vn
Service Provider:VIETNAM POSTS AND TELECOMMUNICATIONS GROUP
Hosted Country:VietnamVN
Location Latitude:16.002
Location Longitude:105.9984
Webserver Software:nginx

Is "VIETNAM POSTS AND TELECOMMUNICATIONS GROUP" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
VIETNAM POSTS AND TELECOMMUNICATIONS GROUP
0.0045%

HTTP Header Analysis for Vccloud.vn

Http-Version: 1.1
Status-Code: 302
Status: 302 Moved Temporarily
Server: nginx
Date: Wed, 21 Oct 2020 20:32:47 GMT
Content-Type: text/html
Content-Length: 138
Connection: keep-alive
Location: https://bizflycloud.vn/

Vccloud.vn Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Vccloud.vn?


Domain Registration (WhoIs) information for Vccloud.vn

Websites with Similar Names

Vcclothing.com
VC Clothing - Streetwear, apparel and screen printing Brisbane
Vccloud.vn
BizFly Cloud - Cung cấp dịch vụ điện toán đám mây tốt nhất tại Việt Nam

Recently Updated Websites

Trvlinspo.com (2 seconds ago.)Iglammakeup.com (2 seconds ago.)Galaxydigital.com (2 seconds ago.)Composition-h.com (4 seconds ago.)Morton1212.com (4 seconds ago.)Kokvip3605.app (4 seconds ago.)Yibobet1613.vip (4 seconds ago.)Yaqibet3748.vip (5 seconds ago.)Boardupchicago.info (5 seconds ago.)Runningcoachshelly.com (5 seconds ago.)Naturalplanetinc.com (5 seconds ago.)Alphastock.gr (5 seconds ago.)Chaseinstitute.com (6 seconds ago.)Javedkhansfightingartsacademy.com (6 seconds ago.)Mariaparaiso.com (6 seconds ago.)Legitmarks.com (7 seconds ago.)07bx.com (7 seconds ago.)Flashrat.net (7 seconds ago.)Boydnature.com (7 seconds ago.)Majestical.guru (8 seconds ago.)Themostperfectperson.com (8 seconds ago.)966mov.com (8 seconds ago.)Therunciblepen.com (8 seconds ago.)23v4.com (8 seconds ago.)Mattstil.es (8 seconds ago.)Haikoujj.net (8 seconds ago.)Morgantaltavull.com (10 seconds ago.)Ssfculoanadministration.com (10 seconds ago.)Glsshwgg.org (10 seconds ago.)Eastsanfordbaptistchurch.org (10 seconds ago.)

Recently Searched Keywords

ecuadorlives (1 second ago.)clang 11.0.0-2~ubuntu20.04.1 (2 seconds ago.)1px solid d7d7d7 (2 seconds ago.)bị tố “lừa đảo” – bạn có thật sự hiểu về mô hình nghỉ dưỡng mới đến từ resorts international việt nam (3 seconds ago.)hell yes: yu darvish is a cy young finalist (3 seconds ago.)iplayer (4 seconds ago.)5900x (4 seconds ago.)2gomovies.to proxy (5 seconds ago.)almalarmz promosyon (5 seconds ago.)amd ryzen threadripper 1950x 16-core vs. amd ryzen threadripper 2950x 16-core vs. amd ryzen 9 3950x 16-core (5 seconds ago.)park or playground (7 seconds ago.)combined-2 (7 seconds ago.)battle ground covid 19 (8 seconds ago.)Ñ�пецкурÑ� «маÑ�тер и маргарита» (8 seconds ago.)samsung 980 nvme ssd linux performance (9 seconds ago.)国投瑞银中高等级债券a (9 seconds ago.)desktop publishing 35s (10 seconds ago.)results intel (10 seconds ago.)wechselrichter pv anlage (12 seconds ago.)20 20 1 (13 seconds ago.)orthos (15 seconds ago.)hoàn kiếm (18 seconds ago.)phovietgroup (18 seconds ago.)kiralk basketbol (19 seconds ago.)jnbsdjiqi (21 seconds ago.)test kit your (25 seconds ago.)tiny houses (26 seconds ago.)tủ lạnh hitachi r-fw690pgv7x (gbk) 540l (26 seconds ago.)weitere themen (26 seconds ago.)tn binh ca (27 seconds ago.)