Vergi, Maliye, Ekonomi, Sosyal Güvenlik, Ticaret Hukuku Hakkındaki Herşey

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: 751,136
Estimated Worth: $1,680
Category: This site has not been categorized yet

Vergialgi.net is a subdomain of Net

VergiAlgi.NET, vatandaşları ve mükellefleri vergi, maliye, ekonomi, sosyal güvenlik konularında bilgilendirmek ve vergi politikalarını izlemek için kurulmuştur.



Domain summary

Last updated
2021-10-16
Domain label
vergialgi
Domain extension
net
Domain registered:
2000-02-00
Domain updated:
2021-01-24
Global Traffic Rank
751,136
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,680
Estimated daily income
$7
Estimated monthly income
$213

Frequently Asked Questions (FAQ)

Q: When was Vergialgi.net registered?
A: Vergialgi.net was registered 21 years, 11 months, 2 weeks, 6 days, 5 hours, 48 minutes, 2 seconds ago on Monday, January 31, 2000.
Q: When was the WHOIS for Vergialgi.net last updated?
A: The WHOIS entry was last updated 11 months, 3 weeks, 6 days, 5 hours, 48 minutes, 2 seconds ago on Sunday, January 24, 2021.
Q: What are Vergialgi.net's nameservers?
A: DNS for Vergialgi.net is provided by the following nameservers:
  • ns1.netprojesi.com
  • ns2.netprojesi.com
Q: Who is the registrar for the Vergialgi.net domain?
A: The domain has been registered at NAME.COM, INC..
Q: What is the traffic rank for Vergialgi.net?
A: Vergialgi.net ranks 751,136 globally on Alexa. Vergialgi.net has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Vergialgi.net each day?
A: Vergialgi.net receives approximately 1,172 visitors and 2,344 page impressions per day.
Q: What IP address does Vergialgi.net resolve to?
A: Vergialgi.net resolves to the IPv4 address .
Q: In what country are Vergialgi.net servers located in?
A: Vergialgi.net has servers located in the .
Q: What webserver software does Vergialgi.net use?
A: Vergialgi.net is powered by Apache webserver.
Q: Who hosts Vergialgi.net?
A: Vergialgi.net is hosted by Unknown in .
Q: How much is Vergialgi.net worth?
A: Vergialgi.net has an estimated worth of $1,680. An average daily income of approximately $7, which is roughly $213 per month.

Vergialgi.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Vergialgi.net Free SEO Report

Website Inpage Analysis for Vergialgi.net

H1 Headings

1 :
  1. Vergi, Maliye, Ekonomi, Sosyal Güvenlik, Ticaret Hukuku Hakkındaki Herşey

H2 Headings

15 :
  1. En Güncel Yazılar
  2. Öne Çıkan Haberler
  3. Vergi
  4. Sesli Makale
  5. Google Ads
  6. Muhasebe-Denetim
  7. Kültür ve Sanat
  8. Ekonomi
  9. Sosyal Güvenlik
  10. Ticaret Hukuku
  11. Araştırmalar
  12. Mükellef Hakları
  13. Son Haberler ve Popüler Yazılar
  14. Yazarlarımız
  15. Kitaplar

H3 Headings

61 :
  1. SMA’lı Çocuklar İçin, Dünyanın En Pahalı İlacını SGK Ödemeli mi?
  2. Elektronik Haciz Uygulamaları
  3. Kırsal Kalkınma Destekleri Kapsamında Yeni Tesise 3,5 Milyon Lira Hibe
  4. Vergi Kayıp ve Kaçağını İhbar Edenlere Son 5 Yılda Ödenen İhbar İkramiyesi Ne Kadar?
  5. İstanbul Comics and Art Festival 16-17 Ekim'de Müze Gazhane'de
  6. Anksiyete Tavan
  7. Akaryakıtta Avrupa’nın En Yüksek Vergili Ülkesinden En Düşük Vergili Ülkesi Konumuna Terfi Ettik
  8. Ot Yiyenler Et Yiyenlere mi Hükmedecek?
  9. Hizmet Tespit Davalarında Vergi Kaybı Ne Olacak?
  10. Yunus Nadi Ödülleri Sahiplerini Buldu
  11. Ne Olacak Bu Enerji Açığı?
  12. Vergi Paketinin Etkisi Nasıl Olacak?
  13. Filmekimi 8 Ekim’de İstanbul’da Başladı
  14. PCP Capital Partners Arap Sermayesini İngiliz Futboluna Çekmeye Devam Ediyor
  15. İstanbul Büyükşehir Belediyesi Sahaf Günleri Sona Erdi
  16. Servet Beyanı Olmadan Vergi Reformu Sadece Laftır
  17. Hazine ve Maliye Bakanlığı Kesinti Yoluyla Ödenen Verginin İadesinde Değişiklik Yapan Tebliği Yayınladı
  18. Teknolojik Gelişmeler ve Kolaylıkları
  19. Kim Kaç Yerden Maaş Alıyormuş; Bize Ne…
  20. Yeni Vergi Kanun Teklifiyle İlgili Değerlendirmelerim
  21. Pilot ve Kabin Memurlarına Ödenen Uçuş Ücreti ve Tazminatının Vergiden İstisna Olması
  22. Vergi Paketinde Neler Var?
  23. Taksiciler ve Vergi
  24. Twitter’ın Bahşiş Özelliğine Vergisel Bir Yaklaşım
  25. YouTuberlara ve Bireysel Yazılım (Uygulama, Oyun) Geliştirenlere Kolay Vergilendirme Geldi
  26. Zarar Mahsubunun Zamanında Yapılmaması
  27. Dünyada ve Türkiye’de Davranışsal Kamu Politikalarının Vergiye Gönüllü Uyumun Artırılmasında Kullanılması-II
  28. Afet Sonrası Vergi Yönetimi
  29. Denetim ve Finansal Raporlama Alanında Güncel Gelişmeler İle Geleceğe İlişkin Beklentiler
  30. Bağımsız Denetimde VUK Finansal Tablolardan UFRS/BOBİ FRS Tablolara Geçişte Verilen Düzeltme ve Sınıflandırma Kayıtları
  31. Kurumsal Yönetim Çerçevesinde İç Denetim Departmanlarında Kalite Ölçütü ve Kalite Güvencesinin Sağlanması
  32. İstanbul Comics and Art Festival 16-17 Ekim'de Müze Gazhane'de
  33. Yunus Nadi Ödülleri Sahiplerini Buldu
  34. Vergi Paketinin Etkisi Nasıl Olacak?
  35. Faiz Artırımı ve Parasal Sıkılaşma Öncesi Reel Sektör Ne Yapmalı?
  36. Orta Vadeli Program (2022-2024) Özel Sektörün Yol Haritası mı?
  37. Kamu Maliyesi Perspektifinden Orta Vadeli Program
  38. Türkiye Cumhuriyet Merkez Bankası Dijital Parası
  39. e-Devlet Hizmetlerinde Kayıtlı Kullanıcı Sayısı 56 Milyonu Aştı
  40. Pandeminin Gölgesinde Sanayi İşletmelerinin Finansmana Erişimi
  41. 25. Yılında AB-Türkiye Gümrük Birliği Revizyonu ve Yeşil Mutabakat Süreci
  42. IMF’in Özel Çekiş Hakları SDR Kotasını Artırması Ne Anlama Geliyor?
  43. Afganistan’da Zenginlik Trajedisi
  44. Niye Öyle Diyorsunuz ki; Bağ-Kur’un da Avantajları Var!
  45. Açıköğretim Deyip Geçme; Oku Sen Evladım!
  46. Benim Kız Evlenirse; Aylık Bana Döner mi?
  47. Sermaye Kaybı ve Borca Batıklığa İlişkin Yeni Düzenlemeler
  48. Şirketlerde Sermaye Kaybının Hesabında Önemli Değişiklik
  49. Hamiline Yazılı Hisse Senetlerine Kayıt Sistemi Geliyor! (Son Baskı)
  50. Vergi Algısı ve Uyum Anketi Sonuçları Belli Oldu: Mevzuatı Bilenlerin 79,43’ü Zor ve Anlaşılması Güç Buldu
  51. Cumhuriyet, güçsüzlerin gücüdür
  52. Dar Mükelleflerin Türkiye’de Sahip Oldukları Gayrimenkul ve İştirak Hissesi Satışlarında Vergilendirme Nasıl Olur?
  53. Kesinti Yoluyla Ödenen Verginin İadesinde Gelinen Son Durum
  54. OECD Üyesi Ülkelerde ve Türkiye’de Mükellef Haklarının Karşılaştırılması-II
  55. OECD Üyesi Ülkelerde ve Türkiye’de Mükellef Haklarının Karşılaştırılması-I
  56. Hazine ve Maliye Bakanlığı ve Gelir İdaresi’ne Teşekkürler
  57. Aftan Yararlanma Zımnen Kabul müdür?
  58. Sosyal Medya Krizinin Perde Arkası
  59. Sosyal Medya Tarihinin En Büyük Krizi
  60. Haziran’da Doları Olan Kazandı. TL Mevduat, DİBS ve Borsa İstanbul Yatırımcısı Kaybetti
  61. YENİ E-KONOMİ Dergisinin 2. Sayısı Çıktı: “Gençlik 4.0”

H4 Headings

4 :
  1. Vergi Konseyi Tamamen Yenilendi
  2. Akaryakıtta Avrupa’nın En Yüksek Vergili Ülkesinden En Düşük Vergili Ülkesi Konumuna Terfi Ettik
  3. Kesinti Yoluyla Ödenen Verginin İadesinde Gelinen Son Durum
  4. Sigorta Prim Borçlarından Kişilerin Sorumlulukları: Türk Ticaret Kanunu ve SGK Uygulaması

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

77 :

Google Adsense

:
pub-1368589411526775

Google Analytics

:
Not Applicable

Links - Internal

125:

Links - Internal (nofollow)

0:

Keyword Cloud for Vergialgi.net

bizticaretolaraklk2021vergidenen vergininduygu menteekonomihaklarekonomi maliyearatrmalarbasnda bizticaretfinansaladesindeeyllgvenlikmkellef haklarekonomiyardmdenen verginin adesindeduygu menteekonomi maliye414 ekimvergiolacaksanat 11nasl30 eyllgelimelerve sanat 1111 ekim 202111 ekimve trkiyedemaliyearatrmalarbasnda2haklarmenteekonomi maliyeekimvemaliye 11 ekimticaretve sanattrkiyedegvenlikmkellefverginintemmuzdenensanat 11 ekimmaliye 11haklarekonomi maliyearatrmalarbasnda05gvenlikmkellef haklarekonomi maliyearatrmalarbasndanehaklarekonomigncelvergisi0704 ekimmkellefmenteekonomistanbulbeyanname0vergiliverginin adesinde3gvenlikmaliyeyoluyla denenekim 20210814 ekim 2021sanatsonyoluyla denen vergininmaliyearatrmalarbasnda bizticaretyoluylami04duyguekimde07 ekim1

Longtail Keyword Density for Vergialgi.net

KeywordsOccurences
11 ekim 20219
14 ekim 20216
ve sanat 114
sanat 11 ekim4
gvenlikmkellef haklarekonomi maliyearatrmalarbasnda3
haklarekonomi maliyearatrmalarbasnda bizticaret3
duygu menteekonomi maliye3
maliye 11 ekim3
yoluyla denen verginin3
denen verginin adesinde3
ekim 202115
11 ekim12
07 ekim7
14 ekim7
ve sanat6
04 ekim5
ve trkiyede4
sanat 114
30 eyll3
verginin adesinde3
denen verginin3
gvenlikmkellef haklarekonomi3
yoluyla denen3
haklarekonomi maliyearatrmalarbasnda3
menteekonomi maliye3
duygu menteekonomi3
maliyearatrmalarbasnda bizticaret3
maliye 113
ve43
ekim33
eyll19
015
112
maliye11
vergi11
28
077
37
sanat6
ne5
denen5
son5
045
trkiyede5
gelimeler4
2021vergi4
finansal4
temmuz4
nasl4
gvenlik4
vergili4
duygu4
menteekonomi3
beyanname3
lk3
vergisi3
mkellef3
olarak3
43
053
ticaret3
083
gvenlikmkellef3
maliyearatrmalarbasnda3
haklarekonomi3
bizticaret3
gncel3
mi3
haklar3
adesinde3
verginin3
yoluyla3
stanbul3
ekimde3
olacak3
yardm3

Who hosts Vergialgi.net?

Vergialgi.net Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Apache

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%

HTTP Header Analysis for Vergialgi.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 16 Oct 2021 02:02:42 GMT
Server: Apache
Accept-Encoding: gzip, deflate
Cache-Control: max-age=86400, public
Expires: Sun, 17 Oct 2021 02:02:42 GMT
Pragma: no-cache
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1
Strict-Transport-Security: max-age=63072000; includeSubDomains; preload
Content-Language: tr
Content-Encoding: gzip
Vary: Accept-Encoding
Upgrade: h2,h2c
Connection: Upgrade
X-UA-Compatible: IE=edge
X-Content-Type-Options: nosniff
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Vergialgi.net Domain Nameserver Information

HostIP AddressCountry
ns1.netprojesi.com 159.253.39.184Turkey Turkey
ns2.netprojesi.com 159.253.39.184Turkey Turkey


Need to find out who hosts Vergialgi.net?


Domain Registration (WhoIs) information for Vergialgi.net

 Domain Name: VERGIALGI.NET
Registry Domain ID: 1701079260_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.name.com
Registrar URL: http://www.name.com
Updated Date: 2021-01-24T06:02:06Z
Creation Date: 2012-02-08T10:01:35Z
Registrar Registration Expiration Date: 2022-02-08T10:01:35Z
Registrar: Name.com, Inc.
Registrar IANA ID: 625
Reseller:
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Whois Agent
Registrant Organization: Domain Protection Services, Inc.
Registrant Street: PO Box 1769
Registrant City: Denver
Registrant State/Province: CO
Registrant Postal Code: 80201
Registrant Country: US
Registrant Phone: +1.7208009072
Registrant Fax: +1.7209758725
Registrant Email: https://www.name.com/contact-domain-whois/vergialgi.net
Registry Admin ID: Not Available From Registry
Admin Name: Whois Agent
Admin Organization: Domain Protection Services, Inc.
Admin Street: PO Box 1769
Admin City: Denver
Admin State/Province: CO
Admin Postal Code: 80201
Admin Country: US
Admin Phone: +1.7208009072
Admin Fax: +1.7209758725
Admin Email: https://www.name.com/contact-domain-whois/vergialgi.net
Registry Tech ID: Not Available From Registry
Tech Name: Whois Agent
Tech Organization: Domain Protection Services, Inc.
Tech Street: PO Box 1769
Tech City: Denver
Tech State/Province: CO
Tech Postal Code: 80201
Tech Country: US
Tech Phone: +1.7208009072
Tech Fax: +1.7209758725
Tech Email: https://www.name.com/contact-domain-whois/vergialgi.net
Name Server: ns1.netprojesi.com
Name Server: ns2.netprojesi.com
DNSSEC: unSigned
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.7203101849
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-10-16T02:02:43Z

Websites with Similar Names

Vergi-raste.online
nothing here...
Vergi.com
vergi.com -&nbspThis website is for sale! -&nbspver gi Resources and Information.
Vergi.com.tr
DT | DENETİM TURKEY – Modern işletmecilik çözümleri uzmanı…
Vergi.tc
VERGI TC Bilgi Elinizin Altinda...

Recently Updated Websites

Et-ha.com (1 second ago.)Ibanhero.com (5 seconds ago.)Uurist.com (6 seconds ago.)Acepnow.com (10 seconds ago.)Magneticpiston.com (12 seconds ago.)Ghanavoips.com (16 seconds ago.)Kok5976.com (16 seconds ago.)Beautylaunchpad.org (18 seconds ago.)Cocker.it (19 seconds ago.)Orkneyphysiotherapy.com (20 seconds ago.)Bod.school (23 seconds ago.)Vergara.com.py (25 seconds ago.)Acreawards.com (26 seconds ago.)Epicollaborative.com (29 seconds ago.)Zx8701.com (33 seconds ago.)Perezstore.com (36 seconds ago.)Johnscustomwoods.com (37 seconds ago.)Byecorrea.com (38 seconds ago.)Courtneyherb.com (43 seconds ago.)Piscesmarket.com (43 seconds ago.)Auto-laweta.net (46 seconds ago.)Eqmindcoach.org (46 seconds ago.)Dinocup.net (47 seconds ago.)Jameslockehart.com (50 seconds ago.)Blackbrick.in (53 seconds ago.)Amylinart.com (56 seconds ago.)Jessthemaker.com (57 seconds ago.)Bwsheatingandair.com (58 seconds ago.)Gorillacoating.com (59 seconds ago.)Iqcoinery.com (1 minute ago.)

Recently Searched Keywords

stuticreation.in (1 second ago.)stellenmarkt (2 seconds ago.)play song (2 seconds ago.)sandbox for kids (4 seconds ago.)laptop bags cases (4 seconds ago.)pvs (5 seconds ago.)lakeland bank credit card (6 seconds ago.)txtv100 (7 seconds ago.)a propos de moi (8 seconds ago.)sers 8378115000 (9 seconds ago.)txtv100 (10 seconds ago.)порно звезди (14 live) (10 seconds ago.)my clearslide (11 seconds ago.)порядок оплаты (11 seconds ago.)gbb aw (12 seconds ago.)perapr (12 seconds ago.)you play (14 seconds ago.)it business (16 seconds ago.)httpsformsgledurumt2mogo5o6ap6rnu003cbru003ernrnfor reporting close (18 seconds ago.)okeydokeyfilms (18 seconds ago.)discord support chat (19 seconds ago.)aoavip (21 seconds ago.)saola (22 seconds ago.)768px+homepage-bannerssection-1547207887284 (23 seconds ago.)irise tower (25 seconds ago.)石狮服装城 (25 seconds ago.)germany (1937274) (25 seconds ago.)bisaya to tagalog (27 seconds ago.)aphrodisiaka anzeigen (27 seconds ago.)тернопіль (29 seconds ago.)