Vergi | Vergi ve Mali Mevzuat | VergiNET


Domain summary

SafetyLow trust score
Year Founded
2005
Global Traffic Rank
157,283
Estimated Worth
$79,800
Last updated
2022-05-07
Domain label
verginet
Domain extension
net
Domain registered:
2005-05-17
Domain updated:
2016-04-28
Domain expires:
2022-05-17
Statvoo Rating
F
Estimated daily income
$133
Estimated monthly income
$4,045

Frequently Asked Questions (FAQ)

Q: When was Verginet.net registered?
A: Verginet.net was registered 17 years, 1 month, 1 week, 2 days, 20 hours, 20 minutes, 40 seconds ago on Tuesday, May 17, 2005.
Q: When was the WHOIS for Verginet.net last updated?
A: The WHOIS entry was last updated 6 years, 1 month, 4 weeks, 20 hours, 20 minutes, 40 seconds ago on Thursday, April 28, 2016.
Q: What are Verginet.net's nameservers?
A: DNS for Verginet.net is provided by the following nameservers:
  • drcns01.deloitte.com.tr
  • ns01.deloitte.com.tr
Q: Who is the registrar for the Verginet.net domain?
A: The domain has been registered at PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM.
Q: What is the traffic rank for Verginet.net?
A: Verginet.net ranks 157,283 globally on Alexa. Verginet.net has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Verginet.net each day?
A: Verginet.net receives approximately 10,631 visitors and 53,155 page impressions per day.
Q: What IP address does Verginet.net resolve to?
A: Verginet.net resolves to the IPv4 address 213.194.87.118.
Q: In what country are Verginet.net servers located in?
A: Verginet.net has servers located in the Turkey.
Q: What webserver software does Verginet.net use?
A: Verginet.net is powered by webserver.
Q: Who hosts Verginet.net?
A: Verginet.net is hosted by Vodafone Net Iletisim Hizmetleri Anonim Sirketi in Istanbul, Istanbul, Turkey, 34379.
Q: How much is Verginet.net worth?
A: Verginet.net has an estimated worth of $79,800. An average daily income of approximately $133, which is roughly $4,045 per month.

Verginet.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Verginet.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Verginet.net

H1 Headings

6 :
  1. İhracatçı ile Üreticiye Kurumlar Vergisi Oranının 1 Puan İndirimli Uygulanmasına İlişkin Taslak Tebliği Yayınlandı.
  2. Menkul Satış Sözleşmelerinde TL Cinsinden Ödeme Zorunluluğu Getirilmesine İlişkin Hazine ve Maliye Bakanlığı Duyurusu Yayınlandı.
  3. 7394 Sayılı Kanun Resmi Gazete'de Yayımlandı.
  4. Yeni Yayınlanan Özelgeler 2022/2
  5. Transfer Fiyatlandırması, Kontrol Edilen Yabancı Kurum ve Örtülü Sermayeye İlişkin Formu Doldururken Dikkat Edilecek Önemli Hususlar ve Son Hatırlatmalar
  6. Aynı Holding Bünyesindeki Firmaya veya Grup Firmasına Döviz Borcu Verilmesine İlişkin Sermaye Hareketleri Genelgesinde Değişiklik Yapıldı

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

42 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-5948315-2

Links - Internal

149:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Verginet.net

gmrkswipercontainer9datml yaz2ylnda yaynlanandemirel gmrk mavirisirklerloop true slidesperviewswiperbuttonnextyaymland 2942022ymmyaymland3spacebetween 10akura ymmfiyatlandrmashesaplamaturkishgressiileteknolojileriuygulanmasna likinvergisimerkurumlar vergisiarzu akuradeloittevergi teknolojileri sirkuleritrkbenveniste992 slidesperviewhakknda yazbreakpoints 992fazlasnbreakpointsdemir10 preventclicks 0vergislidesperviewtrueswipercontainer loopve hbaradehakknda datmlpreventclicks 0kdemvarhakknda datml yazbreakpoints 992 slidesperview6takvimpaginationclickablesirkuleripreventclicks 0 nextbuttondeiiklik11yaynlanan zelgelerarzubar demirel gmrkhbarkdem ve hbardemirel gmrkarzu akura ymmyaz yaymlandspacebetweenve hbar tazminatuygulanmasnaswiperbuttonprev breakpoints 992likingressi benvenistetransferylndakurumlarcezalaryaynlanangmrk mavirimer demirhesaplamalardatml yaz yaymlandyazvemaviri0zelgelerspacebetween 10 preventclickstmdairtrue slidesperviewfirmadatmlmer demir smmmvergi teknolojilerisirkleridemirelslidesperview 2nextbuttonpreventclicks10swipercontainer loop truekanunu17true spacebetween 10swiperbuttonprev breakpoints10 preventclicksdemeyaz yaymland 2942022smmmprevbuttonhakknda yaz yaymland13hakkndabartrue spacebetweenpaginationclickable true spacebetween8loopakurahracatbar demirel12paginationclickable truedemir smmmkararswiperbuttonprev540 nextbuttonylnda yaynlanan zelgeler992 slidesperview 2tazminatteknolojileri sirkuleriswiperbuttonnext prevbuttonkdem veyehbar tazminatloop truenew

Longtail Keyword Density for Verginet.net

KeywordsOccurences
ylnda yaynlanan zelgeler8
arzu akura ymm5
vergi teknolojileri sirkuleri5
hakknda datml yaz5
datml yaz yaymland5
hakknda yaz yaymland4
yaz yaymland 29420224
bar demirel gmrk4
demirel gmrk maviri4
spacebetween 10 preventclicks3
breakpoints 992 slidesperview3
swiper-button-prev breakpoints 9923
preventclicks 0 nextbutton3
10 preventclicks 03
kdem ve hbar3
true spacebetween 103
paginationclickable true spacebetween3
loop true slidesperview3
swiper-container loop true3
ve hbar tazminat3
mer demir smmm3
992 slidesperview 23
yaz yaymland9
yaynlanan zelgeler9
ylnda yaynlanan8
vergi teknolojileri6
hakknda datml5
datml yaz5
akura ymm5
teknolojileri sirkuleri5
arzu akura5
bar demirel5
slidesperview 25
ve hbar4
demirel gmrk4
gmrk maviri4
yaymland 29420224
hakknda yaz4
0 nextbutton3
preventclicks 03
swiper-button-next prevbutton3
swiper-button-prev breakpoints3
breakpoints 9923
10 preventclicks3
spacebetween 103
true spacebetween3
paginationclickable true3
kdem ve3
true slidesperview3
loop true3
swiper-container loop3
gressi benveniste3
demir smmm3
mer demir3
uygulanmasna likin3
kurumlar vergisi3
hbar tazminat3
992 slidesperview3
ve32
sirkler23
vergi13
zelgeler11
gmrk11
yaymland11
hakknda10
likin10
smmm10
vergisi9
yaynlanan9
yaz9
ylnda8
slidesperview6
tm6
fazlasn6
teknolojileri6
true6
demirel5
hracat5
bar5
datml5
akura5
karar5
deiiklik5
05
arzu5
ymm5
deloitte5
deme5
15
sirkuleri5
25
34
maviri4
cezalar4
hbar4
var4
hesaplama4
44
54
new4
64
kanunu4
ile4
dair4
swiper-button-prev3
swiper-container3
loop3
breakpoints3
kdem3
swiper-button-next3
prevbutton3
preventclicks3
paginationclickable3
nextbutton3
spacebetween3
73
benveniste3
83
takvim3
demir3
gressi3
firma3
kurumlar3
trk3
uygulanmasna3
93
103
hesaplamalar3
113
123
tazminat3
turkish3
sirkleri3
mer3
ye3
ade3
fiyatlandrmas3
transfer3
133

Who hosts Verginet.net?

Verginet.net Hosting Provider Information

Hosted IP Address:213.194.87.118
Hosted Hostname:213.194.87.118
Service Provider:Vodafone Net Iletisim Hizmetleri Anonim Sirketi
Hosted Country:TurkeyTR
Location Latitude:41.0479
Location Longitude:28.9773
Webserver Software:Not Applicable

Is "Vodafone Net Iletisim Hizmetleri Anonim Sirketi" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
%

Verginet.net Domain Nameserver Information

HostIP AddressCountry
drcns01.deloitte.com.tr 213.194.80.227Turkey Turkey
ns01.deloitte.com.tr 62.244.251.230Turkey Turkey

Websites with Similar Names

Vergi-raste.online
nothing here...
Vergi.com
vergi.com - This website is for sale! - ver gi Resources and Information.
Vergi.com.tr
DT | DENETİM TURKEY – Modern işletmecilik çözümleri uzmanı…
Vergi.tc
VERGI TC Bilgi Elinizin Altinda...

Recently Updated Websites

Deccomaudio.com (8 seconds ago.)Peibeachrental.com (9 seconds ago.)Triharyadi.web.id (9 seconds ago.)Gzaba.org.cn (9 seconds ago.)Story-telling.fr (13 seconds ago.)Pizzachoppers.com (13 seconds ago.)Ultra-minimalist.com (15 seconds ago.)Meaction.net (16 seconds ago.)Hurriedhostess.com (17 seconds ago.)Wf-kleidung-fahjen.de (18 seconds ago.)Truegritvt.com (20 seconds ago.)Knowledgesight.com (23 seconds ago.)Middlegamevc.com (24 seconds ago.)Support.criteo.com (24 seconds ago.)Asterisk143.org (24 seconds ago.)Reviewdots.com (27 seconds ago.)Ebihara-mitsuo.com (28 seconds ago.)Oceangarages.com (29 seconds ago.)Demiellis.com (29 seconds ago.)Halleeavelyn.com (31 seconds ago.)Tracking.deltadefense.com (31 seconds ago.)Rac.ro (33 seconds ago.)Agrobirmingen.com (33 seconds ago.)Cryptouli.com (34 seconds ago.)Cinekid.nl (36 seconds ago.)Ganba-taisou-mino.com (37 seconds ago.)Revoltaglobal.cat (37 seconds ago.)Viethuong.com.vn (38 seconds ago.)Adastrapress.org (40 seconds ago.)Kebs.xyz (43 seconds ago.)

Recently Searched Keywords

sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked (1 second ago.)فروشگاه اسباب بازی های توی ( hi toy )پاسداران8,036 بازدید 2 سال پیش (1 second ago.)iusto ut (1 second ago.)xplore tv mk (2 seconds ago.)饥荒(灵幻版) (3 seconds ago.)use-iconfill3b5998sqs-slide-wrapperdata-slide-typelock-screen (3 seconds ago.)sd-company (3 seconds ago.)рецепты (4 seconds ago.)unirely (4 seconds ago.)специальные программы президента рф (6 seconds ago.)dou demo (6 seconds ago.)dina uppgifter (7 seconds ago.)button-style-outlinesqs-modal-lightbox form-wrapper (7 seconds ago.)undefined if wdpseventstack0length (8 seconds ago.)waterfront bed (8 seconds ago.)data-slice-typetwitternotdata-compound-type tweet-body (9 seconds ago.)dual battery charger (9 seconds ago.)bumper to bumper (10 seconds ago.)best places to live in dubai (10 seconds ago.)записать голос онлайн с эффектами (10 seconds ago.)svgheight17pxwidth17pxrrssb-buttons li (11 seconds ago.)data-slice-typealbum sqs-slice-album-playliststacked (11 seconds ago.)morgen dort so (12 seconds ago.)berufsbegleitende ausbildung erzieher berlin schulen (12 seconds ago.)profesjonalne usługi w zakresie p… (13 seconds ago.)social-icons-size-mediumsocial-icons-style-border (13 seconds ago.)harga plafon (13 seconds ago.)water carpet cleaner (14 seconds ago.)uniformes industria alimenticia monterrey (14 seconds ago.)quintas para casar na costa alentejana (14 seconds ago.)