Vernonelectric.org Favicon Vernonelectric.org

Vernonelectric.org Website Thumbnail
Checking...
Home | Vernon Electric Cooperative
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
vernonelectric
Domain extension
org
Domain registered:
2000-05-18
Domain updated:
2020-09-30
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is vernonelectric.org ranked relative to other sites:

Percentage of visits to vernonelectric.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Vernonelectric.org registered?
A: Vernonelectric.org was registered 20 years, 5 months, 6 days, 3 hours, 13 minutes, 25 seconds ago on Thursday, May 18, 2000.
Q: When was the WHOIS for Vernonelectric.org last updated?
A: The WHOIS entry was last updated 3 weeks, 3 days, 3 hours, 13 minutes, 25 seconds ago on Wednesday, September 30, 2020.
Q: What are Vernonelectric.org's nameservers?
A: DNS for Vernonelectric.org is provided by the following nameservers:
  • ns97.worldnic.com
  • ns98.worldnic.com
Q: Who is the registrar for the Vernonelectric.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Vernonelectric.org?
A: Vernonelectric.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Vernonelectric.org each day?
A: Vernonelectric.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Vernonelectric.org resolve to?
A: Vernonelectric.org resolves to the IPv4 address 192.124.249.52.
Q: In what country are Vernonelectric.org servers located in?
A: Vernonelectric.org has servers located in the United States.
Q: What webserver software does Vernonelectric.org use?
A: Vernonelectric.org is powered by Sucuri/Cloudproxy webserver.
Q: Who hosts Vernonelectric.org?
A: Vernonelectric.org is hosted by Sucuri in United States.
Q: How much is Vernonelectric.org worth?
A: Vernonelectric.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Vernonelectric.org?

Vernonelectric.org Hosting Provider Information

Hosted IP Address:192.124.249.52
Hosted Hostname:cloudproxy10052.sucuri.net
Service Provider:Sucuri
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Sucuri/Cloudproxy

Is "Sucuri" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Vernonelectric.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: Sucuri/Cloudproxy
Date: Wed, 30 Sep 2020 12:52:23 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
X-Sucuri-ID: 13002
Host-Header: e172abecbd394f56a1a2479517f27fbfe05ff815
Location: https://vernonelectric.org/

Vernonelectric.org Domain Nameserver Information

HostIP AddressCountry
ns97.worldnic.com 207.204.40.149
ns98.worldnic.com 207.204.21.149


Need to find out who hosts Vernonelectric.org?


WhoIs information for Vernonelectric.org

 Domain Name: VERNONELECTRIC.ORG
Registry Domain ID: D27401641-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-03-19T06:54:47Z
Creation Date: 2000-05-18T21:18:56Z
Registry Expiry Date: 2025-05-18T21:18:56Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: Vernon Electric Cooperative
Registrant State/Province: WI
Registrant Country: US
Name Server: NS97.WORLDNIC.COM
Name Server: NS98.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-26T04:09:48Z

Vernonelectric.org Free SEO Report

Website Inpage Analysis for Vernonelectric.org

H1 Headings

0 :

H2 Headings

4 :
  1. Latest
  2. Resources
  3. Quick Links
  4. Follow us today!

H3 Headings

3 :
  1. SmartHub - Online Access
  2. Energy Efficiency Incentives
  3. Renewables

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

7 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-16006774-1

Links - Internal

64:
  1. Pay Online
    http://vernonelectric.org/pay-online
  2. Contact Us
    http://vernonelectric.org/contact-us
  3. Outage Map
    http://vernonelectric.org/outages
  4. No text
    http://vernonelectric.org/
  5. Sign up for Evergreen to receive green power for as little as $1.00 per month!
    http://vernonelectric.org/evergreen
  6. Home
    http://vernonelectric.org/
  7. My Account
    http://vernonelectric.org/my-account
  8. Payment Options
    http://vernonelectric.org/payment-options
  9. SmartHub How-To
    http://vernonelectric.org/smarthub-how
  10. Start or Stop Service
    http://vernonelectric.org/start-or-stop-service
  11. Update My Contact Info
    http://vernonelectric.org/update-my-contact-info
  12. Energy Assistance
    http://vernonelectric.org/energy-assistance
  13. Capital Credits
    http://vernonelectric.org/capital-credits
  14. 2017 Unclaimed Capital Credit Checks
    http://vernonelectric.org/2017-unclaimed-capital-credits
  15. 2020 Returned Capital Credit Checks
    http://vernonelectric.org/2020-returned-capital-credit-checks
  16. Rates
    http://vernonelectric.org/rates
  17. Frequently Asked Questions
    http://vernonelectric.org/frequently-asked-questions
  18. Services
    http://vernonelectric.org/services
  19. Rebates
    http://vernonelectric.org/rebates
  20. Renewables
    http://vernonelectric.org/renewables
  21. Evergreen
    http://vernonelectric.org/evergreen
  22. Net-Metering
    http://vernonelectric.org/net-metering
  23. Community Solar Farm
    http://vernonelectric.org/community-solar-farm
  24. Off-Peak Heating/EV Charging
    http://vernonelectric.org/peak-heatingev-charging
  25. Dual Fuel
    http://vernonelectric.org/dual-fuel
  26. Storage Heat/EV Charging
    http://vernonelectric.org/storage-heatev-charging
  27. New Construction
    http://vernonelectric.org/new-construction
  28. Underground Locating
    http://vernonelectric.org/underground-locating
  29. Electric Grills
    http://vernonelectric.org/electric-grills
  30. Economic Development
    http://vernonelectric.org/economic-development
  31. Forms
    http://vernonelectric.org/forms
  32. Operation Round Up
    http://vernonelectric.org/operation-round
  33. Yard Lights
    http://vernonelectric.org/yard-lights
  34. Efficiency & Safety
    http://vernonelectric.org/efficiency-safety
  35. Energy Audit Rebate Program
    http://vernonelectric.org/energy-audit-rebate-program
  36. Dairy Farm Rewiring Program
    http://vernonelectric.org/dairy-farm-rewiring-program
  37. Use Energy Wisely Guide
    http://vernonelectric.org/use-energy-wisely-guide
  38. Save Money, Save Energy App
    http://vernonelectric.org/save-money-save-energy-app
  39. Efficient Lighting
    http://vernonelectric.org/efficient-lighting
  40. The Right Landscaping For The Right Place
    http://vernonelectric.org/right-landscaping-right-place
  41. Safety Quiz
    http://vernonelectric.org/safety-quiz
  42. Together We Save
    http://vernonelectric.org/together-we-save
  43. About Us
    http://vernonelectric.org/about-us
  44. Annual Meeting
    http://vernonelectric.org/annual-meeting
  45. History
    http://vernonelectric.org/history
  46. Our Affiliates
    http://vernonelectric.org/our-affiliates
  47. News/Annual Report
    http://vernonelectric.org/newsannual-report
  48. Announcements & Events
    http://vernonelectric.org/events
  49. Employment
    http://vernonelectric.org/employment
  50. Bylaws
    http://vernonelectric.org/bylaws
  51. Cooperative Principles
    http://vernonelectric.org/cooperative-principles
  52. Our Mission
    http://vernonelectric.org/our-mission
  53. Touchstone Energy Cooperatives
    http://vernonelectric.org/touchstone-energy-cooperatives
  54. Director, Staff & Service Area
    http://vernonelectric.org/director-staff-service-area
  55. No text
    http://vernonelectric.org/evergreen
  56. No text
    http://vernonelectric.org/payment-options
  57. Scholarship Applications
    http://vernonelectric.org/scholarships-applications
  58. FAQ
    http://vernonelectric.org/frequently-asked-questions
  59. Area Contractors
    http://vernonelectric.org/area-contractors
  60. Renewable Energy
    http://vernonelectric.org/renewables
  61. Privacy Policy
    http://vernonelectric.org/privacy-policy
  62. Non-discrimination Statement
    http://vernonelectric.org/non-discrimination-statement
  63. Site Disclaimer
    http://vernonelectric.org/site-disclaimer
  64. Terms of Service
    http://vernonelectric.org/terms-service

Links - Internal (nofollow)

0:

Links - Outbound

9:
  1. My Account
    https://vernonelectric.smarthub.coop/Login.html#login:
  2. Load Control Status
    http://xso.dairylandpower.coop/lm/LCstatus_xres.html
  3. No text
    https://www.facebook.com/VernonElectric
  4. No text
    https://www.youtube.com/channel/UCVGHDvGUoWWDd7RxGYWPAew
  5. Online Marketplace
    https://electricsense.amcgmarketplace.com
  6. Business Energy Adviser
    https://biznetwork.touchstoneenergy.com/resource-library
  7. No text
    https://electricsense.amcgmarketplace.com/
  8. Youth Leadership Congress
    http://www.weca.coop/youth-leadership-congress
  9. Access My Account
    https://vernonelectric.smarthub.coop/Login.html#login:

Links - Outbound (nofollow)

0:

Keyword Cloud for Vernonelectric.org

programsmarthubonlineour missionfarmcapital credit checksefficientampaccountcapital creditmyrebates renewablesussafetycontactrightcooperativecredit checksevergreenvernon electriccontact uscommunityrebateselectricpaycreditpay onlinemy account0ourvernonrenewablesupefficiencyenergywecapitalsavereportpowerchargingservicemissionchecksuse

Longtail Keyword Density for Vernonelectric.org

KeywordsOccurences
capital credit checks4
pay online4
my account4
capital credit4
credit checks4
contact us3
rebates renewables3
our mission3
vernon electric3
energy15
our12
online7
capital6
save6
my6
amp6
us6
service6
contact5
electric5
efficiency4
charging4
farm4
community4
pay4
checks4
credit4
program4
right4
cooperative4
account4
safety4
efficient3
we3
mission3
renewables3
use3
rebates3
03
smarthub3
power3
evergreen3
up3
report3
vernon3

Vernonelectric.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Vernonelectric.org is a scam?

Websites with Similar Names

Verno-info.ru
Сеть супермаркетов Верный
Verno59.ru
402 - payment required
Vernocchi.com
VERNOCCHI.zero Concessionario Land Rover e Peugeot Rimini e Pesaro
Vernoe-agency.ru
Разработка, создание и продвижение Интернет сайтов
Vernoeming.nl
Vernoeming.nl - De namenfluisteraar
Vernoeslovo.com
Верное Слово | Как достигать успеха в публичных выступлениях
Vernofx.ru
vfxAlert - Binary options signals
Vernoh.com
Vernoh Store – Alles was du brauchst
Vernois-traiteur.com
Vernois Traiteur | Réceptions Sur-Mesure | Grand-Est & Luxembourg
Vernois.net
Apache2 Ubuntu Default Page: It works

Recently Updated Websites

Trustagroomer.com 1 second ago.Premiumdetailers.com 1 second ago.Maxmovies.online 2 seconds ago.Mishelladesigns.com 2 seconds ago.Ryofuan.com 2 seconds ago.Clarksallsports.com 2 seconds ago.Megamoolahjackpot.com 3 seconds ago.Rockonliving.com 3 seconds ago.4fotos1palabra.info 4 seconds ago.Tarynmanias.com 4 seconds ago.Onethousandandonesomewheres.com 4 seconds ago.Mzstyle.net 4 seconds ago.Msiax.com 5 seconds ago.Boxedtriangle.com 5 seconds ago.Sexy-natural-girls.com 5 seconds ago.Drsliu.com 5 seconds ago.Friendshillapiary.com 6 seconds ago.Atlanticgastro.com 6 seconds ago.3344011.com 7 seconds ago.Firstchoiceseamless.com 7 seconds ago.Dist20aa.org 7 seconds ago.Camasdeferro.net 7 seconds ago.Rasmussenchiropractic.com 8 seconds ago.Xn--mojodecaa-s6a.org 8 seconds ago.Stocktradeacademy.com 9 seconds ago.Starwarsintheclassroom.com 9 seconds ago.Adrel.com.br 9 seconds ago.Citylit.ac.uk 9 seconds ago.Hempflops.com 10 seconds ago.Serialstime.net 11 seconds ago.