Vhata.net  |  Jonathan Hitchcock's blog | Jonathan Hitchcock - Vhata Vas Hyah
Low trust score  | 



Vhata.net Website Information

Website Ranks & Scores for Vhata.net

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Domain Information for Vhata.net

Domain Registrar: GANDI SAS
Registration Date:2007-03-22  1 decade 2 years 1 month ago
Last Modified:2015-01-21  4 years 3 months 4 weeks ago
Expiration Date:2020-03-22  9 months 3 weeks 1 hour from now

Whois information for vhata.net

Full Whois Lookup for Vhata.net Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Vhata.net. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: VHATA.NET
Registry Domain ID: 888146527_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.gandi.net
Registrar URL: http://www.gandi.net
Updated Date: 2015-01-21T16:39:51Z
Creation Date: 2007-03-22T11:18:59Z
Registry Expiry Date: 2020-03-22T11:18:59Z
Registrar: Gandi SAS
Registrar IANA ID: 81
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +33.170377661
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: A.NS.VHATA.NET
Name Server: B.NS.VHATA.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-08T11:08:43Z

Who hosts Vhata.net?

Vhata.net is hosted by Hetzner Online GmbH in Germany.
Vhata.net has an IP Address of 188.40.178.1 and a hostname of salt.omnia.za.net and runs Apache/2.2.22 (Ubuntu) web server.



Vhata.net Web Server Information

Hosted IP Address:188.40.178.1
Hosted Hostname:salt.omnia.za.net
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache/2.2.22 (Ubuntu)

HTTP Header Analysis for Vhata.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 29 Jan 2016 17:56:22 GMT
Server: Apache/2.2.22 (Ubuntu)
X-Powered-By: PHP/5.3.10-1ubuntu3.14
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Last-Modified: Fri, 29 Jan 2016 17:56:22 0000
Cache-Control: no-cache, must-revalidate, post-check=0, pre-check=0
ETag: "1454090182"
Content-Language: en
X-Generator: Drupal 7 (http://drupal.org)
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 36364
Content-Type: text/html; charset=utf-8


Need to find out who hosts Vhata.net?

Vhata.net Free SEO Report

Website Inpage Analysis for Vhata.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Vhata.net

pieceneildemocracycurrentlyattitudecandidatesif youadvertslovebroughtdreamaskedbituserwatchingmoneyother wordshandlebackfourreallyinventionmaybeexactlyjohn mccainorderyourethen theyoncedoesanythey haveyearwaysinnovationbeing intelligentwontresultswithoutusinggoogletwittertripassumption2findingsimplyinterestinggettingthey werecampaignshehaveno matterimespeciallydo someideassomebodythreewhile imsearch interfacepeopleimaginemanphrasewhile you0dofollowersscriptsideworkyour product betterthing to dogiveandroidsayingcertainusefulthirdtryingleastracecompaniesgetsnewslongeridentityhappenwhetherbut peoplefive yearspointdetailsrightinternetmay notfollowingamazingamerican dreamthoughstucksetgoesonlinethinkimplementbarackcommandyou makereasonworksalsoif youreyou dont eveneachinterestedtheir tribeif you tryturn outtruemapssomewhatfairlyyou mayconnectsdontthenawaymarketbecause theyhas beenhavingeverythingownhelong tailintolessfetchnevercreatingtogetherdoneknowingdont havefirst timehadread morewebworkedgendershouldhardtakenhatesincepossiblevinny linghambut itsyou trybrain crackotheralmostif you dontwhilesiteproblemagreetastesaddbut thereinvolvednewwasntmightyou justhearimportantchancewrittenproductsearch formneedwelltriggeredgoogle mapsrobynnstartedshowits notdo in capelittletheyrefive peoplecommon interestlookinginsteadinterestfeelwe havehugehard enoughwonrealcompletethoughtvinnyserviceyou wantsamesawwaynecessityappsellfriendsmore about thoughtsperfectlyimplementationyou wereproducemachine breadlotpoliticalobama hasyourselfafricatownpost youmewhile im therepersonyour productenjoysayimpossiblethosefreeverifiedgetspendwebsitesso youyouveobviouslytherenumbertailconceptmakeformeverydaymccainleaderobama has beenopeningswantedassumptionseven realiseoneexcellentleftthings to dodrivethatsfinallyhispeople uselargesshkeytakemassespersonalenoughcantyour friendscomingsuchjonathan hitchcockgroupgoalrunwrotecrazywedcasecoresmallviewwant to knowvotedostuffctfinalnottimeaboveentrynobodybandwidthmy friendsdo somethingcalledlatestcourseintelligenttribepresidentialpersonalitythinkingseemnowleavehasofferingusedstuffgotwebsiteseelatertrygoing viralphoneputholdsouthillwhatever yourdo thingsenormouseventalkthey dontgreatif theywholefileyou haveone is heresynthasiterecentlyactuallypostsdownlivecalifornialifemakingworthrecentamericanhopehomedescribesmatterdont evenproblemsbeforeforwarddiscussingachievetribesherrestrictedfirstslightlythoughts from americaaccountventuremade melast yeareverbettermost1everyquickambesttheresafterplacethemselvesruggedinterfacetwobecomesperfecthave beenevery timewantone oftenthrougholdonesofficesnational identityrealiseseriesbelievetime youchangepensionwebablebetweenim notwhoseyour jobseeingafricanimplementingobviouscanoutmartinpartexpectgodinsitesblogshowingresultquiteallowsubscribeexperiencewe cantheyveyou getobamaeach othernationalbeenovermatter how muchdignitysannothinglookexampleheremarketersmonthnicheratherlistviralforcedbehindsouth africaturnfoundwhichpresentedmembersim therelinghammarketingmaydumpeasilyreturnalreadyseemsmediadifficultfewyourssolotsitsscpbothcape townletpublicthey wantdont thinkincomesolutionseththem butrelevantwalkseconddont even realiseiveimmediatelysucceeddump scriptjonathancan actuallyanybodyfnamhimsomethemetalkingyouve gotcontributeyou canbigcompanymyspecificyou dont havethandoing thingsprocessoffalwayseasymanymichaelcitydayother peopledump on machinereaderofficethey canusersmadethoughtspoliticsamericanobleheadhe hasindividualismdatabasetheypositiondevelopersjust doesntagainsortcommonitselffactisntalthoughfixidealareafindreachyou needhimselfthesethemupgodifferencetimesupdateyearsjohnfriendyoull gettalksbut nowthoughtsgoingyou knowbut theysomethingtoodrawnbasicallythoughtspoliticsamerica readbrainreadingfacebookharderfirmcontentfollowermoreemployeesallfranciscobusinessyou dothoughtspoliticsamerica read morerunningdifferentthere wereanythinganothersolvedmucheverybodyissuesscottfightyourpostenjoyedagainstonlyavailablemakesverythingsbarack obamacomeagojobwork outyoufiveyescreatetheirbecomehoweverbunchsuccessexamplestestingsuccessfulwhateverworlddoesntjustsearchmeansusknowtalentedheardcouldpartyaroundperiodicallyideadeservestartamericano longereven thoughbadourrealisedinternalnot justfacegoodyoullbeingeffecttrivialbuildhitchcockyou dontillustrateoftencapeappliedsimplerichnobutapplehe saidletssayswereproduct betterusearticleseems likeactuallastlikecracksort of thingdecentmediocritymovingoriginalifsituationseth godinbuild upfollowappsmachinesan francisconationbasedmaterialthinggood ideaamountintellectualdiddidntcommunitylongconsiderhave a lotwouldmore thanwordsactivitiesive saidcountrystillsaidbecausefillidentifydoingglobalknewduringamusinggoogle readerappealgeeksyou shouldshould not

Longtail Keyword Density for Vhata.net

KeywordsOccurences
thoughts from america6
thoughtspoliticsamerica read more3
have a lot3
obama has been3
more about thoughts3
matter how much3
you dont have3
while im there3
if you try3
one is here3
thing to do3
do in cape3
dont even realise3
you dont even3
things to do3
your product better3
dump on machine3
if you dont3
sort of thing3
want to know3
if you19
you can19
cape town17
jonathan hitchcock11
american dream11
read more10
your product10
you dont9
you have9
no matter9
machine b8
because they8
we have8
long tail8
has been8
your job7
but its6
dont have6
he said5
other people5
you need5
may not5
you try5
we can5
do something5
they can5
work out5
if youre5
you get5
you may4
no longer4
dont think4
san francisco4
then they4
dump script4
more than4
you know4
dont even4
your friends4
you should4
you want4
he has4
they have4
can actually4
brain crack4
its not4
last year4
south africa4
common interest4
they want4
have been4
time you4
ive said4
not just4
their tribe4
john mccain4
you do3
while you3
five years3
turn out3
im there3
while im3
but they3
thoughtspoliticsamerica read3
national identity3
barack obama3
obama has3
just doesnt3
first time3
there were3
youve got3
google maps3
being intelligent3
hard enough3
youll get3
product better3
made me3
five people3
they dont3
vinny lingham3
one often3
but people3
so you3
post you3
even though3
if they3
build up3
each other3
seth godin3
they were3
my friends3
im not3
other words3
doing things3
every time3
seems like3
them but3
google reader3
you just3
do some3
you were3
but now3
search interface3
people use3
you make3
good idea3
even realise3
whatever your3
but there3
do things3
going viral3
should not3
search form3
you178
have83
they77
people76
but69
your65
not61
if57
can56
one50
there50
do50
more50
he50
has46
its42
so41
them41
just40
because38
things38
dont37
we37
my36
their35
which34
think32
me31
other31
only30
get30
idea30
work29
out28
up28
ideas28
some27
way27
actually26
like26
product25
even25
now25
machine25
all24
tribe24
no24
make24
being23
want23
good23
his21
something21
should21
use21
really21
new20
america20
cape20
time20
youre19
job19
read19
been19
said19
would19
town18
know18
going18
first18
im18
thing17
american17
users17
may17
back17
had16
post16
were16
lot16
example16
start16
obama16
say16
dump16
ive15
very15
find15
than15
however15
run15
problem15
scp15
well15
these15
two15
dream15
see15
interesting14
our14
here14
need14
into14
blog14
any13
making13
google13
while13
then13
jonathan13
somebody13
site13
try13
over12
seems12
thoughts12
money12
much12
content12
enough11
useful11
long11
thought11
hard11
common11
five11
look11
excellent11
together11
always11
bad11
b11
her11
hitchcock11
another11
might10
friends10
doing10
matter10
small10
still10
most10
using10
apps10
problems10
theres10
command10
become10
africa10
also10
world9
many9
could9
stuff9
company9
having9
course9
often9
script9
never9
behind9
without9
interest9
user9
take9
person9
obvious9
interested9
sort9
before9
own8
necessity8
better8
give8
market8
great8
tail8
anything8
used8
create8
did8
us8
search8
national8
employees8
global8
realise8
large8
since8
article8
everybody8
each8
around8
follow7
seth7
different7
form7
vinny7
youll7
anybody7
believe7
whole7
him7
south7
done7
hope7
tribes7
same7
old7
youve7
she7
point7
doesnt7
come7
mccain7
day7
got7
simply7
yourself7
california7
against7
reading7
few7
recently7
whatever7
year7
trying7
process7
put6
able6
go6
maybe6
talk6
robynn6
running6
thats6
nation6
certain6
almost6
add6
synthasite6
man6
life6
every6
consider6
ways6
personality6
saying6
made6
through6
based6
between6
part6
maps6
although6
looking6
twitter6
already6
didnt6
wont6
makes6
achieve6
instead6
last6
found6
words6
those6
finding6
interface6
away5
implement5
build5
getting5
yours5
periodically5
though5
solution5
internet5
possible5
list5
successful5
three5
too5
number5
office5
wrote5
service5
amount5
am5
talking5
business5
testing5
following5
brain5
does5
app5
ssh5
easily5
themselves5
turn5
discussing5
group5
rather5
seeing5
latest5
experience5
best5
head5
key5
party5
works5
longer5
especially5
real5
slightly5
theyre5
posts5
exactly5
whether5
becomes5
means5
results5
gets5
third5
african5
itself5
invention5
home5
recent4
least4
happen4
lots4
case4
original4
friend4
both4
less4
appeal4
ever4
position4
creating4
leave4
fetch4
phrase4
relevant4
after4
order4
quite4
spend4
down4
quick4
niche4
vote4
during4
ideal4
web4
francisco4
details4
deserve4
success4
hear4
lets4
reason4
companies4
produce4
update4
let4
agree4
concept4
ill4
marketing4
area4
database4
nothing4
worked4
bandwidth4
basically4
expect4
big4
again4
crack4
easy4
subscribe4
presented4
04
innovation4
right4
written4
live4
phone4
little4
theme4
wed4
says4
assumptions4
actual4
ago4
realised4
implementation4
years4
san4
ones4
above4
john4
city4
taken4
reach4
fight3
perfectly3
identity3
triggered3
country3
gender3
pension3
mediocrity3
internal3
godin3
brought3
series3
trip3
once3
change3
month3
talented3
succeed3
finally3
entry3
geeks3
fairly3
knew3
intellectual3
describes3
times3
off3
martin3
called3
individualism3
won3
somewhat3
show3
hold3
piece3
race3
campaign3
13
barack3
watching3
issues3
presidential3
drive3
bit3
thoughtspoliticsamerica3
walk3
rich3
face3
23
final3
decent3
file3
intelligent3
connects3
rugged3
everyday3
fnam3
candidates3
dignity3
political3
noble3
adverts3
side3
hate3
restricted3
involved3
huge3
online3
wanted3
himself3
examples3
complete3
seem3
saw3
neil3
leader3
true3
solved3
knowing3
wasnt3
applied3
return3
offices3
venture3
identify3
moving3
chance3
allow3
websites3
free3
thinking3
everything3
started3
drawn3
love3
news3
media3
theyve3
specific3
masses3
currently3
public3
account3
whose3
crazy3
follower3
followers3
trivial3
members3
worth3
attitude3
offering3
enjoy3
asked3
personal3
harder3
lingham3
verified3
scott3
stuck3
enjoyed3
nobody3
contribute3
forward3
democracy3
fact3
website3
dostuffct3
four3
apple3
sell3
tastes3
showing3
immediately3
enormous3
important3
obviously3
core3
view3
goes3
sites3
difficult3
android3
set3
second3
difference3
yes3
heard3
place3
situation3
left3
feel3
openings3
result3
michael3
implementing3
income3
coming3
simple3
talks3
marketers3
viral3
impossible3
reader3
such3
later3
assumption3
activities3
facebook3
perfect3
bunch3
isnt3
material3
firm3
imagine3
illustrate3
developers3
goal3
amazing3
available3
forced3
handle3
community3
effect3
amusing3
fix3
cant3
fill3

What are the nameservers for vhata.net?

Vhata.net Domain Nameserver Information

HostIP AddressCountry
a.ns.vhata.net 188.40.178.1Germany Germany
b.ns.vhata.net 46.101.28.199Russia Russia

Vhata.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Vhata.net is a scam?