Автотехцентр VIANA | Автосервис, разборка, магазин автозапчастей

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Разборка автомобилей Volkswagen Audi Skoda Ford Opel Hyundai, автосервис, магазин автозапчастей, доставка.



Domain summary

Last updated
2021-05-01
Domain label
viana
Domain extension
ru
Domain registered:
2000-05-17
Domain updated:
2021-05-01
Domain expires:
2021-05-31
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Viana.ru registered?
A: Viana.ru was registered 21 years, 8 months, 1 week, 3 days, 15 hours, 15 minutes, 9 seconds ago on Wednesday, May 17, 2000.
Q: When was the WHOIS for Viana.ru last updated?
A: The WHOIS entry was last updated 8 months, 3 weeks, 5 days, 15 hours, 15 minutes, 9 seconds ago on Saturday, May 1, 2021.
Q: What are Viana.ru's nameservers?
A: DNS for Viana.ru is provided by the following nameservers:
  • ns1.platformalp.ru
  • ns2.platformalp.ru
Q: Who is the registrar for the Viana.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Viana.ru?
A: Viana.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Viana.ru each day?
A: Viana.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Viana.ru resolve to?
A: Viana.ru resolves to the IPv4 address 85.119.149.99.
Q: In what country are Viana.ru servers located in?
A: Viana.ru has servers located in the Russia.
Q: What webserver software does Viana.ru use?
A: Viana.ru is powered by Openresty webserver.
Q: Who hosts Viana.ru?
A: Viana.ru is hosted by Academinform JSC in Russia.
Q: How much is Viana.ru worth?
A: Viana.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Viana.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Viana.ru Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Viana.ru

H1 Headings

2 :
  1. Разборка автомобилей
  2.  Оставьте заявку и мы пришлем вам стоимость запчасти 

H2 Headings

11 :
  1. Онлайн-запись в автосервис
  2.  
  3. Доставка запчастей от 300₽
  4. Почему мы?
  5. Всегда в наличии!
  6. Заказ день в день!
  7. Поиск по VIN
  8. Услуги автосервиса
  9. Опытные мастера обеспечат вам высочайшее качество ремонта. Наши сертификаты можно увидеть здесь.
  10. Наш магазин и ремонтный цех
  11. Офисы компании

H3 Headings

13 :
  1. Volkswagen  Audi  Skoda  Ford  Opel
  2. Не тратьте время на звонки. Запишитесь на ремонт через наш сайт и мастер согласует с Вами удобное для Вас время посещения.  
  3. Доставляем по всей России!
  4. найти запчасть
  5. доставить  
  6. установить  
  7. Заявка
  8. Стенд диагностики ходовой - "MAHA" 
  9. Оборудование "HELLA GUTMANN" компьютерная диагностика всех систем
  10. Уважаемые покупатели! Перед выездом просим вас звонить уточнять стоимость и наличие интересующих запчастей.
  11. Уважаемые покупатели! Перед выездом просим вас звонить уточнять стоимость и наличие интересующих запчастей.
  12. Уважаемые покупатели! Перед выездом просим вас звонить уточнять стоимость и наличие интересующих запчастей.
  13. Уважаемые покупатели! Перед выездом просим вас звонить уточнять стоимость и наличие интересующих запчастей.

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

30 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-150383243-1

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Viana.ru

inputchecked radiobefore opacityrgb230 25 25cursor pointer node156metawidth 100 textaligndisplay inlineblock14pxcolor rgb0rgb163plpfieldprivacybuttonnode278plpfieldselectmenu3 0bordertopleftradiustextdecorationrgb230 130 25flexgridalignsides left nametransform1 transformwidthnode48rgb226 0whiteplpfieldradiolist span verticalalignleft textalign rightrelative transition 300msopacity 08noneselementsgridcellcell4 widthplpfieldradiovisual bgimage widthborderbottomwidthflexgridalignsidespaddingbottomnode155paddingleft 0node152nowrapselementsgridcellcell0 width 100importantscale0520pxpaddingright 20pxfontsizebgimage tickplpfieldfile svg widthnode212black15px 0px1pxborderbottomwidth 3pxborderleftwidthrelative zindex 1rgb163 0 2bordertopwidth300ms allfontsize 21pxcenter node155metascale0 transitionundefinedpx paddingright0 height 100node131 node160meta5pximportant paddingleft 5pximportantleft marginbottomrgb0 0 0node167name fontweightnode194plpfieldradiovisual items display21top 0 width14px fontfamily roboto20px lineheight 0textdecoration none16pxfontweight boldcolornode325node160meta inputchecked1 minwidth 50backgroundcolor rgb245 245node91topscreenxs node156meta plpfieldradiovisualnode84backgroundrepeat repeatnode269node291node3cursor pointer node154meta0bordercolor rgb163allplpfieldprivacytext35px paddingbottom130 2525pxborderstyle solidbordertopwidth 0pxborderbottomwidth04radio margin 0documentbodyclientwidth 992fontsize 20pxfa fontsize 18pxnone positionopacity 05 fontsizetop 500 width 22pxbreakword whitespacepaddingright 0px paddingbottompaddingtop 50px paddingbottomnode15screenxs node160metanode156meta plpfieldselectmenubackgroundcolor rgb255 255opacity 0 node157metanode221768 documentbodyclientwidthwrapper1 color255bordercolorlabel margintop0bordercolor rgb145 0rgba226 0 3plpfieldradiovisual tick svgpaddingright 0 node1760 3boxshadowsolidbordertopwidth 0pxborderbottomwidth 0pxborderleftwidthrgb183 00 node156meta0pxbordertoprightradiusrgba183 0left centerbgimage tick node156metapaddingright undefinedpx paddingbottom14px fontfamilynbspnbsp nbsp nbspflexgridalignleft right textalign1 screenxs25pxborderbottomrightradiusbackgroundsize cover backgroundrepeatnode201hidden node156meta225pxtextalign center marginbottompaddingright 15px24pxinherit cursor pointernbsp nbsp whatsappnode6plpfieldradiolist spanboxshadow insetwrapper1plpfieldfile flexgrid display0 node157metadocumentbodyclientwidth 768verticalalign top textalignleft 00 paddingrectfillnone fill none40fontfamilypaddingbottom 61pxnode229plpfieldcheckboxlist spanwidth 22px heightplpfieldresultplpfieldradiovisual item widthnode160meta plpfieldprivacycheckboxpaddingbottom 50pximportantrgb230 130right fontsizeflex flexwrap0pxbordercolor rgb181node111pxborderrightwidthheight 0plpfieldresult flexgridalignsides1pxcolormarginbottom 5px0px paddingright 5px8pxpaddingleftcontainer22pxnode1535px paddingleft 5pxrgb40rgba255 255 255plpfieldprivacycheckboxplpfieldcheckboxvisual inputfocusautorobotonode159meta plpfieldradiovisualspacebetweenverticalalign middle node160meta50 paddingleftnode23node54tick node158metaplpfieldprivacytext fontsize2paddingtop 10pxpaddingbottom 10pxpaddingleftrgb230 165node21width 75nbsp nbspnbsp nbspnode115borderbottomstylenode2440pxborderbottomwidth23px0 node176fontsize 20px lineheightflexgridaligncenter left textalign242 2420 2bordercolor rgb1635pxborderbottomrightradius1pxborderbottomwidthwidth 50 paddingleftcirclefillnone100px opacitymiddle margintop 5pxnode23825 paddingtopselementsgridcellwrapper paddingtop 225px5px padding 12pxnode182node159meta plpfieldcheckboxlistopacity 05 cursorlabel margintop 7333333333333333pxpolygonverticalalign middle node157meta9001900radio boxshadow inset55px 0rgb230 25node82750pxnbsp nbspnbspplpfieldcheckboxlist label labelcolor fffelse ifbreakword texttransform normal0 3bordertopleftradius 25pxbordertoprightradius25 wordwrap breakwordplpfieldradiovisual item displaynode00px6pxpaddingleft 12pxpaddingright 12pxfontsizeinputactive radio3 backgroundcolor rgb242node240marginbottom 10px0 cursoralignitems center node158metanode2878pxpaddingbottompaddingbottom 0pxnode291metafa fontsize 23px20px lineheightwrapper1 backgroundposition leftsslider1arrowrightangleafternode5196pxselementsgridcellcell0 widthnode113flexgrid rightnode2rgb183 0 2bordercolorfontsize 80 cursor100 node156meta12pxfontsize 14pxcolor rgb2551 node160meta plpfieldfilemiddle node154metaalignitems center node155meta1 color black0 0 lineheightbackgroundcolor white colorcenter marginbottom 20px0 0 5pxrgb255 0node63relative backgroundcolorsubnamenode195node159meta plpfieldprivacycheckboxrgba203 0300ms maxwidth 26pxformcontrol heightnode149node158meta plpfieldcheckboxvisualnode154meta plpfieldprivacycheckboxbgimage tick node155metaplpfieldradiovisual inputchecked bgimagetextalign center node157metablock backgroundcolorpaddingtop992 plpscreen0px rgba0 083 230plpfieldradiovisual label positionpointer node160meta1px noneplpfieldradiolistright textalignnode73top 0 leftnode154meta plpfieldfileflexwrap wrapmarginbottom 7px fontsize5px paddingright 5pxplpfieldcheckboxvisualmarginbottom 10px whitespace5 marginlefttick opacity 05normal displaycenter node159metanode161center node154metabackgroundcolor rgba203 0selementsgridcellcell0 selementsgridcellwrapper paddingtop15px paddingrightbgimage tick node154metanowrap screenxsplpfieldprivacybutton openplpfieldprivacycheckbox fontsize 80selementsgridcellcell2 width 100important3boxshadow inset 0px100important paddingleft 10pximportant10px paddingbottom 5pxinputchecked checkboxleft 505pximportant screenmdcenter node160meta100important paddingleftsvg90plpfieldprivacycheckbox input position25pxborderstyle solidbordertopwidthcleanhover0 3 0bordercolor0px paddingright 0pxplpfieldradiolist input positionitem display inlineblock225px paddingbottom 225pxfixed backgroundpositionnode106paddingright 10pximportant screensm10pximportantrectfillnonenode217node2315pximportant paddingleft225pximportantwhatsapp nbspplpfieldradiovisual itemwhitespace normalopacity 0 overflow255boxshadow inset 0pxbackgroundcolor rgba2030px paddingleft 0pxauto display10px 0pxplpfieldcheckboxlist input positionposition relative zindexoverflow hidden node158metacontent display0 2 0bordercolorplpfieldradiolist label labelselementsgridcellcell3 width5px paddingright 10pxcheckbox svgplpfieldradiolist inputnode43node13912pxpaddingright 12pxfontsize 14pxcolor0pxbordertoprightradius 0pxborderbottomrightradius5px paddingright 0pxplpfieldfile flexgrid center025 borderradius 5pxflexgridalignleft rightnode227node154meta plpfieldselectmenuscreensm7333333333333333px2color rgb255255boxshadow 0px 2pxnode2728pxwrapper2solid rgba00bordertopleftradius 0pxbordertoprightradiuscursornode34inner sslider1arrowleftanglebeforewhite borderradius 100pxwrapwrapper1 backgroundattachment fixedplpfieldcheckboxlist inputplpfieldradiovisual items0 2bordertopwidthblock backgroundcolor white2bordercolor rgb163 0padding 0plpfieldradiolist labelverticalalign middle margintopnode228plpfieldcheckboxinputbreakword whitespace normal80 cursor0 paddingright 15pxnode125paddingbottom undefinedpx paddingleftfontfamilyinputfocus bgimage tickplpfieldresult flexgridalignsides displayplpfield paddingbottomnode215plpfieldresult flexgridalignright leftnode291 wrapper1textalign center node160metainputhover bgimage tick50px overflow hidden1 node154meta plpfieldfile100 backgroundcolorpaddingleft 15pxabsolute leftnode160meta plpfieldcheckboxlistnode156meta plpfieldfilenode9verticalalign middle screenxsright opacity20pxfontsize 14pxletterspacingnode34inner sslider1arrowleftangleafter20px justifycontentcover backgroundrepeat norepeatmarginbottom0 05 borderformcontrol height autocolormargin 7px 0svg100 content display50 wordwrap breakwordspan display inlineblocktextarea resizenode245screenxs node160meta plpfieldcheckboxvisual8pxpaddingbottom 8pxpaddingleft 16pxpaddingright3bordertopleftradiusoverflow hidden node157metascreenxs node157meta plpfieldcheckboxvisualheight 20px verticalalignplpfieldradiovisual inputcheckedpaddingbottom 50px paddingleftopacity 08 marginbottomsolidbordertopwidth 1pxborderbottomwidth 3pxborderleftwidthdisplay inlineblock backgroundpositionscreenxs node156meta plpfieldcheckboxvisualpaddingbottom 14px fontsizepaddingtop 0px paddingbottomnode176 selementsgridcellcell3width 30none rgba0 0node255plpfieldresult flexgridalignright right5pxborderstyle solidbordertopwidth0 3 050 cursor pointer0pxbordercolor rgb40tickcenter node156meta plpfieldresultnode158meta inputcheckednode2200 opacityselementsgridcellcell1 selementsgridcellwrapper paddingtop1 transform scale05plpfieldcheckboxvisual tick position20pxfontsizergba0left flexgrow 120px height 20pxinputchecked checkbox bordercolor14pxcolor rgb255 255255 255boxshadow 0px0 height 0hidden node157metabackgroundcolor rgba226 00 55pxnode34breakword textaligncenter node159meta plpfieldresultflexgridaligncenter lefttransition all 300msrgba226node226padding height 100px9100 height 100inputactive checkboxplpfieldhiddenboldcolor rgb40 40width 33333333333333336fontsize 14px wordwrapplpfieldfilespancheckbox svg opacitydocumentbodyclientwidth 992 plpscreencenter center backgroundsize10px paddingbottom0 left 0maxwidth 26pxlineheight 1paddingbottom 14pxrgba203 0 35px marginbottomwrap marginbottom0 00pxbordercoloritemsnode282rgb25505 fontsizenode181node284texttransform uppercasecolor rgb255top 0 heightcheckbox bordercolor rgb255paddingtop undefinedpxposition relative3bordercolorabsolute width 0node154meta inputcheckedborderradius 2px15pximportant255boxshadowbackgroundcolor rgb40 40right flexgrowfloat right12pxfontsize 14pxcolor rgb0radio marginlabel labelposition absolute topplpscreentick position absolutenode135node156meta plpfieldcheckboxvisual1 colordefstexttransform normal letterspacinginputfocus bgimagescreenxs node207backgroundcolor white borderradius100 textalign40 40fontfamilyplpfieldcheckboxinput spanrgb203border1 node159metadocumentbodyclientwidth 1200 plpscreen0 3bordercolor rgb163opacity 025dashed color3 0bordercolor rgb145plpfieldcheckboxvisual subname0 3svg opacitybackground whitescreenxs node156metaflexgridalignright left textalign25pxbordertoprightradius 25pxborderbottomrightradius 25pxborderbottomleftradiusborderradius 5px paddingwrapper2 paddingrightsvg width 1000 3 0bordertopleftradiusnode76node157meta plpfieldcheckboxvisualwidth 100 opacitymiddle paddingleftheight0bordercolorinputchecked bgimage tick0bordercolor rgb1453 0bordertopleftradius 0pxbordertoprightradiuswidth 0boldcolor rgb40uppercasecolor rgb255undefinedpx0px 5pxuppercasecolorlabel position relativecontainersoft maxwidthverticalalign middle node159metaboxshadow5pxborderstyleif documentbodyclientwidth 12001200 plpscreen lg1px borderbottomstylescreenxs node155meta plpfieldcheckboxvisualflexgrid centernode160meta plpfieldradiolist0 015normal letterspacing nonepaddingleft 15pximportant paddingright10pxpaddingbottomnode34innernode158meta plpfieldselectmenu2paddingtop 10pxpaddingbottomcenter backgroundsize coverbordercolor025 position relative5px rgba0bordercolor rgb203 0rgba183fontfamily roboto opacitynbsp nbsp nbspverticalalign middle50px10pxpaddingbottom 10pxpaddingleft 20pxpaddingrightscreensm node54opacity 0 node156meta0 margin0 3bordertopleftradius 5pxbordertoprightradiusboxshadow inset 0pointer zindexall borderradius0 widthcontent display blockscreenxs node158metadefs path fill0pxborderleftwidth 0pxborderrightwidthcenter node155meta plpfieldresult14pxcolornode470 overflow hiddennode1580bordercolor rgb163 0divareascreenmdrgb25transform scale120px justifycontent spacebetweennode191height auto lineheight0 2bordertopwidth 3pxborderbottomwidth24pxfontsizedisplay flexbreakword texttransformtextalign center node156metabgimage tick node158metaformcontrolfocuswithin bordercolorpointer node159metaposition relative backgroundcolornode15624pxfontsize 14pxcolorhidden position0important screenxs node176else if documentbodyclientwidthcursor pointer zindexnode54 selementsgridcellcell1 selementsgridcellwrapperfloatplpfieldhidden opacityformcontrol margintop 10pxinlineblock backgroundposition centeroverflow hiddenpaddingtop 225pximportant paddingbottomtransform scale0labelselementsgridcellwrapper paddingtop 50pximportant25pxborderbottomleftradius 25pxborderstyle80 textalign center2px solid rgba0md elsetextareawhitespace nowrapcenter opacity12px 96px40 color ffftextalign center node155metapaddingright undefinedpxleft245 245divareascreensm2bordertopwidth 3pxborderbottomwidthnbsp whatsappmiddle backgroundrelative zindexflexgridalignsides display flexauto lineheight0pxborderleftwidthnode74plpfieldprivacytext a textdecorationnode197plpfieldprivacycheckbox fontsizenode64paddingleft 0important255 0textdecoration none borderbottomwidthscreenxs node159meta plpfieldradiovisualposition relative transitionnode183wrapper1 backgroundcolor white16pxverticalalign middle node154metarect0px rgba015px paddingright 0113 115formcontrolscreenxs node159metaplpfieldfile spanpaddingleft 15px paddingrightrgb245border 1pxinsetlabel positiontextalign right fontsizeplpfieldradiovisual inputhover bgimagewrapper2 paddingtopbgimage widthwordwrap breakword texttransform3pxborderbottomwidth 1pxcolor rgb255none borderbottomwidth0px 2px 5px0 padding 00 minheight autolineheight 00bordercolor rgb226rgb226paddingright 10pximportantabsolutebackgroundattachment scrollimportantnode270radiobefore opacityhidden position relativeflexgrid displayplpfieldresult flexgridaligncenternode213borderbottomstyle dashed color10pximportant screensmnode1690 3 backgroundcolor14px wordwrap breakwordrgb255 255 2553bordercolor rgb145 0subname width 75node54 selementsgridcellcell0left 0 widthnode29918pxcolor rgb255 255node81node45 wrapper126px position absolutescreenxs node34inner3bordercolor rgb145plpfieldresult flexgrid rightplpfieldprivacycheckbox span verticalalignundefinedpx paddingleft undefinedpx0px rgba226 0300ms maxwidthplpfieldcheckboxlist labelinputactive0pxborderbottomleftradius 0pxborderstyleflexgridalignsides displaypointerplpfieldcheckboxvisual inputcheckedwidth 100 heightnode93node158meta plpfieldprivacycheckbox100 opacity 0rgb255 255 255boxshadownode235fixed backgroundposition centernode46plpfieldprivacycheckbox a verticalalign4px 10px 0px05 verticalalign middle1 minwidth 25width 50pointer node154metaselementsgridcellcell4flexgrow15pximportant screenxs node176plpfieldselectmenu flexgrid left225pximportant paddingleft100 height0px paddingbottom 5pxrgba0 0bordercolor rgb255formcontrol formcontrol margintopboxshadow none position50 wordwraprgba226 08pxpaddingleft 16pxpaddingright 16pxfontsize0 2colornode45marginbottom 20px0pxborderleftwidth 0pxborderrightwidth 0pxbordercolor20pxpaddingright1200 plpscreentick node156metanode121whatsappitems display flexflexgridaligncenter right textalign25 25 screenxs0pxborderbottomrightradius 0pxborderbottomleftradiuswrapper2 backgroundcolornode252textalign center0 3boxshadow insetrgb0rgb145 0minwidth 25 wordwrapoverflow hidden node160meta0pxbordercolor rgb40 4012 boxshadowopacity 0 node155metaplpscreens1 node156meta plpfieldfilenode155meta plpfieldfile1 transform scale1path40 color0 2paddingtop2px 5px 0pxcolor rgb25 83flexgrid left flexgrow075 transition all100important screenxsnode2510px paddingbottom14pxletterspacingnbsp nbsp0 top 0fixed025 borderradiuspaddingleft 10px0px 5px 15pxnbspnbsp nbspscreenxs node154metaboldcolornode114inputchecked radioplpfieldradiovisual labelbordercolor rgb203center borderradius 50pxwrapper2 paddingright 5pximportantdisplay inlineblock verticalalign50 transformclean floatnbsp 705rgb183center flexgrow 115px 0px rgba22616pxpaddingrightbackgroundcolor rgb226 0position relative widthnode273formcontrol margintopdashedoverflow hidden node159metadocumentbodyclientwidth 768 documentbodyclientwidth18pxcolorminwidthwhite color 3330 transform scale0flexgridalignright right75 display inlineblockmarginbottom 20px justifycontentfa fontsize 21pxwidth 20px heightrect fill rgb2260px 4pxopacity 0 node160metaplpfieldcheckboxvisual bgimage3pxborderleftwidth 1pxborderrightwidth 1pxbordercolornode62node14 wrapper1radiobefore opacity 1node254node158meta plpfieldradiolistpadding heightfill noneverticalalign middle paddingleftnode1901pxcolor rgb255 2555px paddingleft 10pxwrapper1 backgroundattachment scrollimportantbreakword5px rgba0 0svg opacity 1node34inner sslider1arrowrightanglebeforeinputchecked bgimagenbsp nbsp nbspnbsp015node1505px paddingbottom 0pxnode160meta plpfieldradiovisualalignitems center node157metabackgroundrepeat20borderbottomwidth 1pxalignitemsformcontrolfocuswithinitems displaynode168flexwrapselementsgridcellwrapper paddingtop 50pxpaddingbottom 0px paddingleftpaddingtop 50pxdisplay block backgroundcolorwrapper1 wrapper2 paddingrightnode156meta plpfieldradiovisual225px paddingleft 0verticalalign middle node155metaplpfieldprivacybutton open textalign26pxpaddingbottom 5pxnode8block cursor1pxborderrightwidth 1pxbordercolorrectfillnone fillcursor pointer node158meta2colorcolor rgb230100 textalign leftbackgroundcolor rgb24220px verticalaligncursor pointerbackgroundcolor rgb203 0radio bordercolor rgb2030pxborderrightwidth 0pxbordercolor rgb405px paddingleft3bordercolor rgb163 0height 22px minheight40paddingtop 6pxpaddingbottom 6pxpaddingleftinherit cursor0 node159metanode160meta plpfieldselectmenurgb230center flexgrow50px overflowname marginbottom 0paddingright 15px node176255 255bordercolor rgb226992 documentbodyclientwidthrgb183 0 2width 25border 2pxdisplay block7px fontsizeleft marginbottom 10pxmargin 0 margincheckbox boxshadowplpfieldcheckboxvisual bgimage widthnone rgba020px width 30padding 12px 96pxleft textalignall borderradius 2pxitem width 100center borderradiuscheckbox svg widthpaddingtop 0pxnode64 wrapper1 wrapper222px minheight automiddle node158metawrapper1 wrapper2 paddingtopbackground white borderbackgroundcolor rgba255 255flexgridaligncenterinlineblockwebkitappearance none75 displaypointer position relativeinputfocus checkbox6pxpaddingbottom 6pxpaddingleft 12pxpaddingrightbordercolor rgb255 1130 node158metacheckbox width 22pxmdpaddingtop 2px255 0bordercolor rgb2260 0 025paddingbottom 225pximportant1 node156metacover backgroundrepeat repeat5px 0px08 marginbottom 7pxmargintop 5pxtextalign leftwrap marginbottom 20pxpaddingrightmiddle background whitecolor rgb25display flex alignitemsbackgroundattachment scrollimportant screensmall 300mswrapper2 paddingtop 2pxplpfieldcheckboxvisual item widthnode186node154meta plpfieldcheckboxlist40 40fontfamily robototransition 300mspadding 12pxmiddle node159metanone position relativefontsize 23pxnode180 textalignnode70node274inputhover bgimagenode237bgimage tick node159metanode198node167 wrapper110pximportant screensm node54opensolidbordertopwidthcenter node156metabackgroundposition leftpaddingleft 10pximportant825pxborderstylewebkitappearanceplpfieldcheckboxlist span verticalaligncenter center25 25absolute widthborderradius 50px overflow20px verticalalign middletextalign center node154metahidden node160metagoupdashed color inherit2bordertopwidth 3pxborderbottomwidth 1pxcolornode157meta inputcheckedabsolute left 50backgroundcolor rgb40display block cursor12pxpaddingrightinputchecked radio bordercolornode176 selementsgridcellcell4255 0bordertopleftradius 0pxbordertoprightradius0 wordwrap breakwordscreenxsnode159meta inputchecked0px 4px 10pxoverflow hidden node156meta1px none rgba001em22px padding12pxpaddingright 12pxfontsize 16pxfontweight05 cursor50 top 50center node160meta plpfieldresult225pximportant paddingleft 0importantbackgroundattachmentif documentbodyclientwidthdivareascreenlgscrollimportantpositionscreenxs node154meta plpfieldcheckboxvisualmarginbottom 7pxplpfieldhidden opacity 025bgimage backgroundsize cover0important screenxsundefinedpx paddingbottomopacity 1 transform225px paddingbottomcolor rgb230 25wrapper2 paddingtop 0px50px paddingbottom 50pxwidth 75 displaynode158meta plpfieldfileinputhover18paddingtop 50pximportant0paddingtop 5px paddingrightplpfieldcheckboxvisual bgimage backgroundsizenode41165 25height 100 opacitydisplay flex flexwrapinitial100 node160meta100 backgroundcolor rgba226node64 wrapper1zindex 1 colorborderradius 5px0 2225pximportant paddingbottom 225pximportant970px12pxfontsize 16pxfontweight boldcolornode167 wrapper1 backgroundattachmentselectnode155meta plpfieldradiolist24pxpaddingright 24pxfontsize 14pxcolornode40 wrapper1inlineblock backgroundpositioncursor pointer node160meta7bordercolor rgb226100px opacity 00pxbordercolor rgb181 02px solidleft name3fa fontsize 20pxcursor pointer node157meta5pxbordertoprightradiuspaddingleft 15pximportantpaddingleft 10px paddingrightdefs pathflexgridaligncenter right0pxborderbottomleftradiustick opacity18px12node77inputzindex 0hidden node155meta2pxnode159meta plpfieldresult2 0bordercolornode156meta inputcheckedwidth 20pxplpfieldresult flexgridalignsides left50px paddingleftbgimageplpfieldresult flexgridaligncenter rightformcontrol formcontrolfontweightflex flexwrap wrap0px paddingleft 5pxposition absoluteopacity 05 verticalalignflex alignitemsbgimage tick node157metanode54 selementsgridcellcell0 width24pxpaddingrightpaddingright 15pximportant screenxsopacity 150pximportantwrapper1 backgroundposition centernode202norepeatplpfieldcheckboxvisual label positionpaddingbottom undefinedpxselementsgridcellcell3paddingleft 5pximportant5px paddingnode34 wrapper12color rgb080 cursor pointernone borderbottomwidth 1pxrgb226 0 3tick node157metafontweight normal fontfamilypaddingright 5pxcursor initialnode156metaplpfieldcheckboxvisual label1pxborderrightwidth 1pxbordercolor rgb1810 node160metasvg86pointer node155metabackgroundrepeat norepeatbackgroundcolor rgb242 242polygonfillnone22borderradius 100px100 opacityplpfieldfile clean0 0 05plpfieldradiovisual subname widthcenter node157meta plpfieldresultinset 0px 2px25pxborderbottomleftradius 25pxborderstyle solidbordertopwidthplpfieldprivacycheckbox span0 2paddingtop 8pxpaddingbottompaddingleft 5 marginleft05 fontsize 80white borderradiusbackgroundcolor rgb2265pxbordertoprightradius 5pxborderbottomrightradius 5pxborderbottomleftradius8pxpaddingleft 24pxpaddingrightplpfieldfile input0 3 042paddingtop 8pxpaddingbottom 8pxpaddingleft05 verticalalignnode68margintop 10px50 top1 minwidthcenter backgroundsize5pxborderstyle solidbordertopwidth 1pxborderbottomwidthnode246paddingleft 10pximportant paddingrightsvg1020important paddingright2flexgridalignright right textalignverticalalign middle node156metanode199paddingright 00 2bordercolorlineheight 0 widthfontsize 18px255 255boxshadow insetrect fillsvg width 20px0 3colorselect positionopacity 0 node158metaundefinedpx paddingleftmd else ifpathfillnonelabel fontweightnode157meta plpfieldradiolistdocumentbodyclientwidth 992 documentbodyclientwidthinset 0 0node10paddingbottom 5px paddingleft191pxbordercolor rgb181100important paddingleft 15pximportantnode45 wrapper1 backgroundattachmentwrapper1 wrapper2wordwrap breakword whitespaceleft textalign centertexttransformnode34inner sslider1arrowrightangleafter0 5px rgba0plpfieldcheckboxvisual input08 marginbottom10pxpaddingleft 20pxpaddingrightborderradius 50pxletterspacing nonenode54 selementsgridcellcell0 selementsgridcellwrappermiddle paddingleft 5paddingleft 0pxnode233absolute toppaddingleft 5px10pximportant paddingrightrepeat color fffnode158meta2paddingtop 6pxpaddingbottomplpfieldcheckboxvisual inputchecked bgimage0 paddingrighttick svgname12pxfontsize 16pxfontweightcenter opacity 05plpfieldradiovisual overflow hiddenborderradius 100px opacity100important screenxs node207plpfieldradiovisual tick positionscreenxs node160meta plpfieldradiovisualzindex 10important paddingright 0importantnode170translate50 50verticalalign middle textdecorationplpfieldcheckboxvisual subname width14pxcolor rgb255paddingright 5px paddingbottomitem widthwidth 33333333333333336 node207inputchecked radiobeforebackgroundcolor rgb1836pxpaddingleft 12pxpaddingrightrelative widthbackgroundattachment fixedplpfieldcheckboxlist50pximportant paddingbottom 50pximportant0 transform1pxcolor rgb2556pxpaddingleftfontsize 14pxselementsgridcellwrapper paddingtop 225pximportant2paddingtop 6pxpaddingbottom 6pxpaddingleft3 0bordercolorpaddingright 0importantflexgrow 1node159meta plpfieldradiolist12pxfontsizeplpfieldcheckboxvisual inputhover15px node176itemwrapper2 paddingtop 5pxheight 22px paddingbackgroundrepeat norepeat colorcenter node158meta plpfieldresultrgb163 0 2color100 content0 3bordercolor rgb145minheight autohidden node158metargb40 40 40fontfamilyclean float right1340paddingtop 6pxpaddingbottomnode260node901 node158meta plpfieldfilenode268100 node157metaopacity 05containersoftfill rgb226node222whitespace nowrap screenxsif documentbodyclientwidth 992node232verticalalign middle lineheight0 3bordercolor5px marginbottom 5px25 verticalalign middleletterspacing245 color0 wordwraplineheight 0 minheightcolor rgb230 165marginbottom 20px widthnode159meta plpfieldfileplpfieldprivacycheckbox input3bordertopleftradius 5pxbordertoprightradiusnode257node950pxborderstyle5pxborderbottomleftradius 5pxborderstyle14px cursorwhitespace25 verticalalign5pxborderbottomrightradius 5pxborderbottomleftradiusnode4rgb25 83sslider1nextfontsize 14px cursorinputactive checkbox boxshadowoverflow hidden positionnode218rgb203 0 3auto lineheight 12node34 wrapper1 backgroundattachmentpaddingtop 50pximportant paddingbottomnode157meta plpfieldselectmenupointer zindex 1300ms opacity 0rgba203node71paddingtop 25 verticalalign255boxshadow 0px 4pxfill rgb226 0plpfieldcheckboxvisual itemplpfieldcheckboxvisual itemsplpfieldcheckboxvisual overflowmargin 0 55px25 screenxsposition absolute leftnode22tick node155metaflexwrap wrap marginbottomnode2640bordercolor rgb226 0repeatcursor pointer position08top 0flexgrow 1 minwidthnbspnbsplg else16pxfontweight boldcolor rgb40textalign left marginbottomsslider1arrowleftanglebefore14cover backgroundrepeat2px paddingrightwhite border 2pxnode193radio bordercolorbordercolor rgb226 00 node154metacheckboxopacity 0 transformheight auto1170px255boxshadow 0pxbackgroundsizenode157meta plpfieldfileoverflow hidden node154metawrapper1 backgroundcolornode6914pxcolor rgb0 015pximportant paddingright 15pximportantabsolute left 0else12pxplpfieldcheckboxvisual tick svgabsolute top 0wrapper1 backgroundpositionnode155meta plpfieldradiovisualminwidth 25verticalalign middle background0bordertopleftradiusscreenxs node157metahidden node159metapaddingleft undefinedpx100 3bordertopleftradius2paddingtop 8pxpaddingbottom7px0 left15pximportant screenxsrgb255 113 115center node158metamiddle lineheight0 top05 border225pximportant paddingbottomboxshadow none3boxshadowpaddingbottom 50pximportant paddingleft100 top8pxpaddingbottom 8pxpaddingleftcolor black8pxpaddingbottom 8pxpaddingleft 24pxpaddingrightbreakword textalign right10pxnode291meta goupinlineblock verticalalignnode159meta plpfieldcheckboxvisualbackgroundcolor rgba183documentbodyclientwidth 120040 40paddingtop 6pxpaddingbottomnbsp whatsapp nbspright fontsize 100paddingright 25pxselementsgridcellcell1 width1 node157meta plpfieldfilefontsize1left 0 topcenter node154meta plpfieldresult50pximportant paddinglefttransform scale05maxwidth2color rgb0 0paddingright 10px node5450pximportant paddingbottomcheckbox widthplpfieldradiovisual subname marginlineheight 12undefinedpx paddingright undefinedpx0 node155metapaddingtop 225pxplpscreen lgtop textalignplpfieldfile cleanhover5pxborderbottomleftradius 5pxborderstyle solidbordertopwidthflexgrid16pxfontweightpaddingtexttransform normalresizecursor pointer node159metanode267minwidth 50wrapper1 backgroundcolor rgb40310px paddingleft8pxpaddingleft 24pxpaddingright 24pxfontsizeelse if plpscreensnormal letterspacingbackgroundcolor rgb2036pxpaddingbottom 6pxpaddingleftplpfieldcheckboxinput inputrgb255 113node158meta plpfieldradiovisual29nbsp1 node155meta plpfieldfilepaddingleft 5pximportant screenmdnode271scrollimportant screensmflexgridalignrighthidden300ms all borderradius3 backgroundcolor rgb226plpfieldfile input positiontextalign center node159meta255 0bordertopleftradius245 color rgba0node51 wrapper1contentnode279flexgridalignleftifsvg94node158meta plpfieldresultnode154meta plpfieldradiolistpaddingleft 5margintop992 plpscreen mdnode158meta plpfieldcheckboxlisttick node154metauppercasecolor rgb255 255paddingright 5pximportantnode1234px 10pxtransform scale0 transitionflexgrid left60pxnode54 selementsgridcellcell2border 1px nonecleanhover opacity 1margin 7px24normal fontfamilymarginnode236rgb226 0 3colorbackgroundcolor rgba183 07 495rgb181 0svg opacity 0backgroundcolor rgb255 0node159node136formcontrolfocus10pxpaddingbottom 10pxpaddingleftverticalrgb25 83 230node615px paddingbottomnode23405 cursor pointerinput positionborderbottomstyle dashed0 5pxfa0 overflowbackgroundsize covernode156meta plpfieldradiolist10pximportant screenxs node543pxborderbottomwidthitem displaynode216margintop 7333333333333333pxnode10840 40middle node160meta26inset 0pxnode286minheight auto displayplpfieldfile flexgridwidth 100 paddingtop255boxshadow inset0 55px 0borderbottomwidth 1px borderbottomstyleheight 2px0pxborderbottomwidth 0pxborderleftwidth0pxborderstyle solidbordertopwidthdisplay noneopen textalign centerbackgroundattachment fixed backgroundpositionwidth 100 topdisplayfontfamily robotonbsp 7 495width 100important paddingleft12pxfontsize 14pxcolornode40 wrapper1 backgroundattachmentcolor rgba0 0plpfieldcheckboxvisual inputhover bgimageformcontrolfocuswithin bordercolor rgb226node155metabgimage tick svgright textalign center14px cursor initialheight 100px3pxborderbottomwidth 1pxcolor3bordertopleftradius 25pxbordertoprightradius2px 5pxnode1195px 0px rgba00important3 050 heightnode157meta plpfieldcheckboxlist0pxbordertoprightradius 0pxborderbottomrightradius 0pxborderbottomleftradiusalignitems center node154metasslider1arrowrightanglebefore30undefinedpx paddingbottom undefinedpxalignitems center node159meta0 2paddingtop 6pxpaddingbottompath fill25 28plpfieldcheckboxvisual ticknode101rgb226 0 3bordertopleftradiusheight 22pxwordwrap breakword textalignnode243255 255 0bordertopleftradiusscreenxs node158meta plpfieldcheckboxvisualblack webkitappearance6pxpaddingbottomnode7path fill noneplpfieldresult flexgridaligncenter leftrgb230 230paddingtop 0px paddingrightbackgroundcolor rgba255label label margintop25px paddingbottompaddingright 35px paddingbottomtransitionnormal display block255bordercolor rgb226 00px 2px0 opacity 0open textaligncleanhover opacitynode423bordercolor rgb163node155meta plpfieldselectmenucircle3bordertopleftradius 5pxbordertoprightradius 5pxborderbottomrightradiusrgb230 165 25rgb181subname width0 width 100top textalign center61pxmiddle margintopnode28311backgroundcolor rgb245marginleft 4pxcleantop 50 transformnode55node156meta plpfieldresult100 top 0node241opacity 0 transitionselect position absolutepaddingleft 0important paddingrightfright textalign rightopacity 1 screenxspaddingleftpaddingleft 0 paddingrightsubname margin 7pxblockscreenxs node159meta plpfieldcheckboxvisual0 2paddingtop 10pxpaddingbottom3pxborderleftwidthrgb242inputhover radio0px rgba226plpfieldcheckboxvisual inputfocus bgimage5pxbordertoprightradius 5pxborderbottomrightradius0 opacity 051 node159meta plpfieldfile285pximportant1pxbgimage backgroundsize0 3color rgb226all borderradius 100px3 075margin 0inputfocus radionode134paddingright 0important screenxsrgb181 0 2paddingtopnode54 selementsgridcellcell2 widthpointer position0 025 borderradiusselementsgridcellcell1 width 100importanttranslate50plpfieldcheckboxvisual overflow hiddennode15455px 0 040paddingtop3bordertopleftradius 25pxbordertoprightradius 25pxborderbottomrightradiusplpfieldresult flexgrid100 paddingtop 100roboto opacity24pxfontsize 14pxcolor rgb0inherittick node160metanode265screenxs node155metabackgroundcolor whitenode187middlefillblack webkitappearance none25pxborderbottomrightradius 25pxborderbottomleftradiusopacitybackgroundposition center borderradiusrepeat color0 minheight1 node155metaopacity 0 node154metapaddingtop 225pximportantauto display inlineblockbackgroundposition center centerflexgrid right flexgrowpaddingbottom 225pximportant paddingleftbackgroundcolor rgba22621pxnode6733333333333333336 node207node154meta0 lineheightrgb245 245paddingbottom 225px paddingleftname marginbottomtextarea resize verticalmarginbottom 01 node158metanode230sslider1previous40fontfamily robotonode176 selementsgridcellcell21 node157meta075node160meta plpfieldcheckboxvisualpadding 0 margincover18pxcolor rgb2552color rgb255 2558pxpaddingleft 16pxpaddingrightbackgroundposition centernode281norepeat colorpaddingleft 35pxsslider1pagecheckbox bordercolor rgb203justifycontent spacebetweenflexgridalignsides leftfontsize 14px fontfamilyposition absolute widthbackgroundpositionselementsgridcellwrapper5 marginleft 4pxinput position absolutecheckbox boxshadow inset255 255 0inputfocus checkbox bordercolortransform translate50norepeat color fffcover displaynode51 wrapper1 backgroundattachmenttextalign rightall 300ms maxwidthbackgroundposition left centercenter marginbottomplpfieldselectmenu select40 40 colorrgb245 245 245rgb242 242 242plpfieldselectmenu flexgrid display40 40paddingtoptextalignblock cursor pointerbgimage tick node160meta14px fontsizescreenxs node155meta plpfieldradiovisualpaddingtop 225px paddingbottomplpfieldradiovisual tick0bordertopleftradius 0pxbordertoprightradius 0pxborderbottomrightradius14pxletterspacing 01emscreenxs node154meta plpfieldradiovisualplpfieldradiovisualpaddingtop 25node154meta plpfieldradiovisualflexgrid center flexgrow4px22px minheight10pxpaddingleft 20pxpaddingright 20pxfontsize0pxborderstyle solidbordertopwidth 0pxborderbottomwidth10px 0px rgba2262 0bordercolor rgb163lgrgb203 0 3bordercolorscale0name fontweight normal16pxfontsize 18pxcolor rgb255right flexgrow 1right opacity 0514px25 wordwrapmargintop 5px marginbottomscale0 transition 300ms0 0 paddinginlineblock verticalalign middlenode70 wrapper1node75plpfieldradiovisual subname20px widthplpfieldcheckboxvisual item display10px whitespaceinputchecked checkbox svgmaxwidth 26px position10pximportant screenxsnode15722px padding 0paddingbottom 50px15px0px paddingrightcolor 333rgba2553 backgroundcolorwidth 100important screenxsnode137textalign center opacityscreenxs node176node54 selementsgridcellcell1 widthtexttransform uppercasecolormiddle node157metargb230 25 28node155meta plpfieldcheckboxvisual0pxborderbottomwidth 0pxborderleftwidth 0pxborderrightwidth0 025 positionhidden node154metatick positionplpfieldresult flexgridalignleft rightnode280inputactive radio boxshadowplpfieldcheckboxvisual subname marginplpfieldselectmenu select positionplpfieldcheckboxinput input position2bordertopwidth55px0 2 0node4020px5pxborderbottomrightradius 5pxborderbottomleftradius 5pxborderstyleplpfieldradiovisual overflowrelative width 100300ms3color rgb226 0selementsgridcellcell225 paddingtop 25width 22pxright textalign leftwordwrapheight 20px0px paddingbottom 0px255 255bordercolor3boxshadow insetfa fontsizenode70 wrapper1 wrapper2selementsgridcellcell1 selementsgridcellwrappernode156meta plpfieldprivacycheckbox612 boxshadow none15pximportant paddingrightnode54 selementsgridcellcell1bgimage width 2516pxpaddingright 16pxfontsizerelative transitionwrapper1 color fffradioopacity 0 node159meta5px paddingleft 0px100 node159metaleft center backgroundsizergb0 0color inherit cursorpaddingright 0pxplpfieldradiovisual bgimage backgroundsizesolid rgba0 0container widthpaddingright 15pximportantpaddingright 10px paddingbottomnode293node34inner sslider1previous2bordercolorrgb163 0solidbordertopwidth 1pxborderbottomwidthplpfieldcheckboxinput span verticalalignnode151node100node54 selementsgridcellcell2 selementsgridcellwrapperalignitems center node156meta25px63pxrgb242 242100 paddingtopplpfieldcheckboxvisual input positionpointer node157meta10px whitespace nowrap100pxpointer node156metanode223node32627100important0 3 075node6520pxpaddingright 20pxfontsize 14pxletterspacingcolor rgba0plpfield paddingbottom 14px245 245 colormiddle textdecorationrgba0 0 0node258height 100 backgroundcolornode157meta plpfieldradiovisualselementsgridcellcell1subname marginrgb203 0 3boxshadow0pxborderbottomrightradiusmarginleft0 transitionselementsgridcellwrapper paddingtopscreenxs node158meta plpfieldradiovisualminheightmiddle node155metanode239255bordercolor rgb22622px height 22pxplpfieldprivacytext fontsize 80node224pointer node158metafontsize 100paddingright 25px paddingbottommiddle node156metawrapper1 backgroundattachment5px2bordercolor rgb1630 lineheight 0lineheightradio bordercolor rgb255fontsize 80 textalignnode76 wrapper1 wrapper2plpfieldfile span display0pxborderbottomrightradius 0pxborderbottomleftradius 0pxborderstyle3colornode242pointer zindex 016plpfieldselectmenu fa fontsize01em texttransform uppercasecolorpaddingright 5pximportant paddingleftplpfieldfile clean floatalignitems center node160meta1pxbordercolor4bgimage tick opacityrgb145 0 2colorfloat right opacityflex2 016pxfontsizeselementsgridcellcell0 selementsgridcellwrapper17tick svg opacitymiddle textdecoration nonenode2567px 0 wordwrap05 border 1pxnode157metaplpfieldfile cleanhover opacitymiddle screenxswordwrap breakwordnode104fontweight normal25pxbordertoprightradius 25pxborderbottomrightradiusopacity 0 cursor15paddingtop 2px paddingright5px 15px 0px25pxborderbottomrightradius 25pxborderbottomleftradius 25pxborderstyle0pxborderbottomleftradius 0pxborderstyle solidbordertopwidthpaddingright 35px255 255left name marginbottomverticalalign topnode102white colorcenter10px paddingright0pxborderrightwidthplpscreen lg elsenode530pxborderrightwidth 0pxbordercolor rgb181paddingright 10pxsectionslidercontainerspan displaynode259justifycontentnode159meta plpfieldselectmenu300ms opacitynode52node155meta plpfieldresultlg else if100 node158meta35pxall 300ms opacity12pxpaddingright 12pxfontsizergba183 0 2inputfocus radio bordercolorselementsgridcellcell0rgb145svg width16pxpaddingright 16pxfontsize 18pxcolornode4996px fontsizepaddingright 10pximportant screenxsheight 0 opacity3color rgb226radio boxshadowwrapper1 color 33350pximportant paddingleft 0importantrgb40 40 40solidbordertopwidth 0pxborderbottomwidth0 margin 0borderradiusplpfieldradiovisual inputhover255 255 0bordercolorplpfieldfile svgnode185plpfieldresize verticalzindexnode225alignitems centerwrapper1 wrapper2 backgroundcolornode160node154meta plpfieldcheckboxvisualrelative14px fontsize 14pxnode14inlineblock verticalalign top0 05rgba255 255inputchecked24pxpaddingright 24pxfontsizebackgroundrepeat repeat colorplpfieldselectmenu flexgridflexgridalignright leftfontsize 80verticalalignnode138border 2px solid255 0bordercolor025 position14pxletterspacing 01em texttransformbackgroundcolor rgb183 0left 50 topplpfieldradiovisual input positionoverflownode155meta plpfieldcheckboxlistnode76 wrapper1rgb40 40 40paddingtopcolor rgb230 130node2537px fontsize 14pxnode214node123pxborderleftwidth 1pxborderrightwidth16pxfontsize 18pxcolorbackgroundnode266node176 selementsgridcellcell1tick node159meta1px borderbottomstyle dashednode160meta plpfieldresult075 transitionspan verticalalign middleplpscreen md elsewidth 33333333333333336 paddingleft24pxfontsize 14pxcolor rgb255node79sslider1arrowleftangleafter10pximportant paddingright 10pximportantwidth 25 paddingtopnode189overflow hidden node155meta3 075 transitionpaddingtop 5pxnode159metaplpfieldresult flexgridalignrightnode160meta plpfieldfilergb203 0radiobefore25node155meta plpfieldprivacycheckboxcover display inlineblockwidth 100important12px 96px fontsizeplpscreen mdscreenmdscreenxs node157meta plpfieldradiovisualleft flexgrownode176 selementsgridcellcell060px paddingbottom5pxborderbottomleftradiusrelative backgroundcolor rgb245backgroundcolor rgb230center node157meta0 0 015node176transition allnode160metapaddingbottom 225pxplpfieldradiovisual bgimageselementsgridcellcell2 selementsgridcellwrapper paddingtop25pxborderbottomleftradius25pxbordertoprightradiuspadding 0 lineheightsvg980 02510px node54width 10033333333333333336 paddingleft255 255boxshadowscreenxs node541 node154metanormalnode154meta plpfieldresultplpfieldcheckboxvisual items displayopacity 0minwidth 50 wordwrapnode1175px paddingrightnode156meta plpfieldcheckboxlistnode103paddingtop 100025radiobefore position20pxfontsize 14pxletterspacing 01emcolor black webkitappearancenode285color inheritlineheight 0 opacity1pxbordercolor rgb181 0width 0 height2paddingtopnormal fontfamily robotospan verticalalign5px paddingbottom 5pxif plpscreensmiddle lineheight 150px paddingbottom0 2color rgb0rightsolid0important screenxs node5450 paddingleft 15pxbackgroundcolor rgb255node219transition 300ms allinset 0rgb255 255selementsgridcellcell2 widthinputhover checkboxlabel fontweight normalcursor pointer node155metaflexgrid display flex5plpfieldselectmenu fa0pxborderrightwidth 0pxbordercolortextalign center node158metaheight 100paddingtop undefinedpx paddingrightnode226meta0 2color rgb255verticalalign middle node158metadocumentbodyclientwidthnode292fffbackgroundcolor96px fontsize 14px50 transform translate50node20726px positiontransform translate50 50radiobefore position absolute7px 03 0423backgroundcolor rgb230 23001em texttransformnode56node34inner sslider1nextinputfocus10pxpaddingleftselementsgridcellcell2 selementsgridcellwrappernode157meta plpfieldresult0 transition alllineheight 12 boxshadowheight 100 contentnode155meta inputcheckedplpfieldresult flexgridalignleftplpfieldradiovisual input14px wordwrapcheckbox bordercolorfontweight normal display22px heightrgb40 40225px paddingleftwhite border20px heightflex alignitems centerbackgroundsize cover display2px paddingright 5px1pxborderbottomwidth 3pxborderleftwidth 1pxborderrightwidthnode157meta plpfieldprivacycheckbox5px 15pxscale1rgb255 255 255bordercolorroboto opacity 08node80

Longtail Keyword Density for Viana.ru

KeywordsOccurences
wrapper1 wrapper2 padding-top175
color rgb230 25159
wrapper1 color 333119
rgba0 0 0112
padding-right 5px padding-bottom111
rgb230 25 28104
padding-bottom 5px padding-left103
wrapper2 padding-top 5px102
padding-top 5px padding-right102
0 0 02590
5px padding-left 5px84
5px padding-bottom 5px83
rgb255 255 25582
background-color rgb203 081
5px padding-right 5px80
0px rgba0 070
5px 0px rgba069
2px 5px 0px69
0px 2px 5px69
2color rgb255 25562
0 2color rgb25562
nbsp nbsp nbsp59
rgb203 0 3border-color58
rgb230 25 2555
background-color rgb226 054
rgb145 0 2color53
rgb181 0 2padding-top53
rgb255 255 255box-shadow52
display inline-block vertical-align49
input position absolute49
wrapper1 color fff47
inset 0px 2px46
rgb226 0 345
padding-bottom 0px padding-left43
padding-right 0px padding-bottom43
width 0 height42
height 0 opacity42
0 height 042
0 opacity 042
absolute width 042
wrapper2 padding-top 0px42
position absolute width42
padding-top 0px padding-right40
rgb226 0 3border-top-left-radius37
rgba226 0 337
0 3border-color rgb14536
0pxborder-left-width 0pxborder-right-width 0pxborder-color36
0pxborder-bottom-width 0pxborder-left-width 0pxborder-right-width36
0 width 10036
solidborder-top-width 0pxborder-bottom-width 0pxborder-left-width36
3border-color rgb145 036
position absolute left35
inline-block vertical-align middle35
2padding-top 8pxpadding-bottom 8pxpadding-left34
0 2padding-top 8pxpadding-bottom34
0px padding-right 0px31
rgba183 0 230
background-color rgba183 030
background-color rgba226 030
0pxborder-color rgb181 030
0px padding-bottom 0px30
0pxborder-right-width 0pxborder-color rgb18130
rgb0 0 029
span vertical-align middle28
transition 300ms all28
inputchecked bgimage tick28
tick svg opacity28
transition all 300ms28
width 100 height28
255 255box-shadow 0px28
100 height 10028
0px padding-left 0px28
opacity 0 overflow28
0 overflow hidden28
rgb163 0 2color27
background-color rgb183 026
5pxborder-style solidborder-top-width 1pxborder-bottom-width24
5pxborder-bottom-left-radius 5pxborder-style solidborder-top-width24
5pxborder-bottom-right-radius 5pxborder-bottom-left-radius 5pxborder-style24
5pxborder-top-right-radius 5pxborder-bottom-right-radius 5pxborder-bottom-left-radius24
fa font-size 18px24
255box-shadow inset 0px24
255 255box-shadow inset24
16pxpadding-right 16pxfont-size 18pxcolor23
1pxborder-bottom-width 3pxborder-left-width 1pxborder-right-width23
3pxborder-left-width 1pxborder-right-width 1pxborder-color23
1pxborder-right-width 1pxborder-color rgb18123
8pxpadding-left 16pxpadding-right 16pxfont-size23
1pxborder-color rgb181 023
8pxpadding-bottom 8pxpadding-left 16pxpadding-right23
3border-top-left-radius 5pxborder-top-right-radius 5pxborder-bottom-right-radius23
16pxfont-size 18pxcolor rgb25523
solidborder-top-width 1pxborder-bottom-width 3pxborder-left-width23
3pxborder-bottom-width 1pxcolor rgb25523
0 3border-top-left-radius 5pxborder-top-right-radius23
0 2border-top-width 3pxborder-bottom-width23
2border-top-width 3pxborder-bottom-width 1pxcolor23
255box-shadow 0px 2px23
1pxcolor rgb255 25523
fa font-size 23px23
18pxcolor rgb255 25523
rgb203 0 3box-shadow22
rgb163 0 2border-top-width22
3border-color rgb163 022
0 3box-shadow inset22
3box-shadow inset 0px22
0 3border-color rgb16322
nbsp nbsp whatsapp22
flex align-items center21
display flex align-items21
left 0 width21
absolute left 021
0pxborder-style solidborder-top-width 0pxborder-bottom-width21
0pxborder-bottom-left-radius 0pxborder-style solidborder-top-width21
100 opacity 021
0border-top-left-radius 0pxborder-top-right-radius 0pxborder-bottom-right-radius21
0pxborder-top-right-radius 0pxborder-bottom-right-radius 0pxborder-bottom-left-radius21
0pxborder-bottom-right-radius 0pxborder-bottom-left-radius 0pxborder-style21
0 3 background-color21
svg opacity 121
flex-grow 1 min-width21
2color rgb0 019
rgba255 255 25519
background-color rgba255 25519
0 2color rgb019
6pxpadding-bottom 6pxpadding-left 12pxpadding-right18
6pxpadding-left 12pxpadding-right 12pxfont-size18
border 2px solid16
text-align center margin-bottom16
rgb203 0 315
background-color rgba203 015
width 100 text-align15
5px padding-bottom 0px15
0px padding-left 5px15
position absolute top15
0 3 0border-top-left-radius15
3 0border-top-left-radius 0pxborder-top-right-radius15
0border-color rgb145 015
rgba203 0 315
2 0border-color rgb16315
0 2 015
0border-color rgb163 015
0 2 0border-color15
0 3 0border-color15
3 0border-color rgb14515
0 margin 014
margin 0 55px14
0 55px 014
55px 0 014
absolute top 014
plp-fieldradio-visual inputchecked bgimage14
5 margin-left -4px14
bgimage tick opacity14
0 line-height 014
min-height auto display14
auto display inline-block14
background white border14
center margin-bottom 20px14
vertical-align middle background14
middle background white14
plp-fieldcheckbox-visual inputchecked bgimage14
white border 2px14
top 0 left14
0 left 014
height 100 opacity14
opacity 0 cursor14
2px solid rgba014
solid rgba0 014
0 025 position14
025 position relative14
tick opacity 0514
75 display inline-block14
padding-left 5 margin-left14
left margin-bottom 10px14
padding-top 25 vertical-align14
25 padding-top 2514
position relative transition14
20px width 3014
margin-bottom 20px width14
background-size cover display14
width 25 padding-top14
bgimage width 2514
white-space nowrap screen-xs14
10px white-space nowrap14
margin-bottom 10px white-space14
text-align left margin-bottom14
middle padding-left 514
100 text-align left14
25 vertical-align middle14
vertical-align middle screen-xs14
item width 10014
opacity 1 screen-xs14
subname width 7514
bgimage tick svg14
width 22px height14
22px height 22px14
width 75 display14
vertical-align middle padding-left14
border-radius 50px overflow14
0 5px rgba014
relative transition 300ms14
top 0 width14
cover display inline-block14
tick position absolute14
item display inline-block14
left 0 top14
0 top 014
inline-block vertical-align top14
vertical-align top text-align14
margin-bottom -20px justify-content14
cursor pointer z-index14
height 100 background-color14
100 background-color rgba22614
0 3 07514
3 075 transition14
075 transition all14
-20px justify-content space-between14
wrap margin-bottom -20px14
all 300ms opacity14
inline-block background-position center14
overflow hidden position14
hidden position relative14
center border-radius 50px14
background-position center border-radius14
label label margin-top14
label margin-top 7333333333333333px14
position relative width14
flex-wrap wrap margin-bottom14
relative width 10014
width 100 padding-top14
100 padding-top 10014
display inline-block background-position14
items display flex14
display flex flex-wrap14
flex flex-wrap wrap14
top text-align center14
300ms opacity 014
300ms all border-radius14
7px 0 word-wrap14
3 background-color rgb22614
border-color rgb203 014
subname margin 7px14
margin 7px 014
rgb255 113 11514
border-color rgb255 11314
0 word-wrap break-word14
box-shadow inset 014
scale0 transition 300ms14
transform scale0 transition14
0 transform scale014
opacity 0 transform14
word-wrap break-word white-space14
break-word white-space normal14
inputhover bgimage tick14
transform translate-50 -5014
inset 0 014
svg opacity 014
absolute left 5014
opacity 0 transition14
0 transition all14
all 300ms max-width14
300ms max-width 26px14
max-width 26px position14
26px position absolute14
left 50 top14
0 0 5px14
50 top 5014
opacity 1 transform14
top 50 transform14
50 transform translate-5014
0 0 01514
5px rgba0 014
50px overflow hidden14
0 cursor pointer14
1 min-width 5014
label position relative14
inherit cursor pointer14
0 3border-top-left-radius 25pxborder-top-right-radius14
3border-top-left-radius 25pxborder-top-right-radius 25pxborder-bottom-right-radius14
25pxborder-top-right-radius 25pxborder-bottom-right-radius 25pxborder-bottom-left-radius14
25pxborder-bottom-right-radius 25pxborder-bottom-left-radius 25pxborder-style14
flexgrid display flex14
25pxborder-bottom-left-radius 25pxborder-style solidborder-top-width14
25pxborder-style solidborder-top-width 0pxborder-bottom-width14
bgimage background-size cover14
min-width 50 word-wrap14
50 word-wrap break-word14
dashed color inherit14
border-bottom-style dashed color14
1px border-bottom-style dashed14
border-bottom-width 1px border-bottom-style14
none border-bottom-width 1px14
text-decoration none border-bottom-width14
color inherit cursor14
rgb183 0 2border-color13
2border-color rgb163 012
center background-size cover12
background-size cover background-repeat12
wrapper1 wrapper2 background-color12
0 2border-color rgb16312
3color rgb226 012
0 3color rgb22612
rgb226 0 3color12
rgb25 83 23012
background-color rgb255 25512
color rgb25 8312
padding-left 0important padding-right11
0 2padding-top 6pxpadding-bottom11
width 100important padding-left11
2px padding-right 5px11
padding-top 2px padding-right11
wrapper2 padding-top 2px11
5px padding-left 0px11
rgb183 0 211
0important padding-right 0important11
2padding-top 6pxpadding-bottom 6pxpadding-left11
0px padding-bottom 5px11
8pxpadding-left 24pxpadding-right 24pxfont-size10
8pxpadding-bottom 8pxpadding-left 24pxpadding-right10
14pxcolor rgb255 25510
12pxpadding-right 12pxfont-size 14pxcolor10
wrapper1 background-attachment scrollimportant10
24pxpadding-right 24pxfont-size 14pxcolor10
5px padding-right 0px10
fa font-size 21px9
14pxcolor rgb0 09
0px padding-right 5px8
background-position center center8
wrapper1 wrapper2 padding-right8
center center background-size8
5px padding-right 10px8
padding-left 0 padding-right8
rgb230 165 258
color rgb230 1658
5px padding-left 10px8
10px padding-bottom 5px8
border-color rgb226 08
padding-right 10px padding-bottom8
right text-align right7
plp-fieldprivacy-button open text-align7
flexgridalign-right right text-align7
plp-fieldresult flexgridalign-right right7
open text-align center7
right text-align center7
font-size 80 text-align7
flexgridalign-center right text-align7
plp-fieldresult flexgridalign-center right7
right text-align left7
flexgridalign-left right text-align7
plp-fieldresult flexgridalign-left right7
text-align right font-size7
break-word text-align right7
word-wrap break-word text-align7
25 word-wrap break-word7
min-width 25 word-wrap7
1 min-width 257
plp-fieldcheckbox-visual subname margin7
text-align center opacity7
middle text-decoration none7
center opacity 057
nbsp whatsapp nbsp7
plp-fieldprivacy-checkbox input position7
80 text-align center7
plp-fieldprivacy-text a text-decoration7
plp-fieldhidden opacity 0257
flexgrid right flex-grow7
plp-fieldcheckbox-visual input position7
plp-fieldcheckbox-visual tick position7
else if documentbodyclientwidth7
plp-fieldprivacy-text font-size 807
opacity 05 font-size7
vertical-align middle text-decoration7
plp-fieldprivacy-checkbox a vertical-align7
plp-fieldprivacy-checkbox span vertical-align7
plp-fieldprivacy-checkbox font-size 807
80 cursor pointer7
font-size 80 cursor7
plp-fieldcheckbox-visual tick svg7
05 font-size 807
right flex-grow 17
black -webkit-appearance none7
plp-fieldresult flexgrid right7
05 vertical-align middle7
plp-fieldradio-visual items display7
plp-fieldradio-visual overflow hidden7
plp-fieldradio-list label label7
plp-fieldradio-list input position7
plp-fieldradio-list span vertical-align7
plp-fieldcheckbox-input input position7
plp-fieldcheckbox-input span vertical-align7
opacity 05 vertical-align7
plp-fieldselect-menu flexgrid display7
plp-fieldradio-visual label position7
plp-fieldselect-menu flexgrid left7
plp-fieldcheckbox-visual subname width7
flexgrid left flex-grow7
left flex-grow 17
plp-fieldcheckbox-visual bgimage width7
plp-fieldfile svg width7
svg width 20px7
width 20px height7
plp-fieldradio-visual item display7
plp-fieldradio-visual bgimage background-size7
20px height 20px7
select position absolute7
1 color black7
z-index 1 color7
pointer z-index 17
plp-fieldselect-menu fa font-size7
fa font-size 20px7
font-size 20px line-height7
20px line-height 07
line-height 0 opacity7
plp-fieldselect-menu select position7
plp-fieldradio-visual input position7
plp-fieldradio-visual subname width7
plp-fieldradio-visual bgimage width7
plp-fieldradio-visual item width7
0 opacity 057
plp-fieldradio-visual inputhover bgimage7
plp-fieldradio-visual subname margin7
plp-fieldradio-visual tick svg7
plp-fieldradio-visual tick position7
plp-fieldcheckbox-visual item width7
height 20px vertical-align7
left text-align right7
flexgridalign-sides display flex7
plp-fieldfile cleanhover opacity7
cleanhover opacity 17
plp-fieldfile flexgrid display7
plp-fieldfile flexgrid center7
flexgrid center flex-grow7
center flex-grow 17
plp-fieldcheckbox-visual inputhover bgimage7
plp-fieldresult flexgridalign-sides display7
plp-fieldresult flexgridalign-sides left7
position relative z-index7
color black -webkit-appearance7
left name margin-bottom7
name margin-bottom 07
plp-fieldresult flexgridalign-center left7
flexgridalign-center left text-align7
left text-align center7
plp-fieldresult flexgridalign-right left7
flexgridalign-right left text-align7
relative z-index 17
pointer position relative7
20px vertical-align middle7
plp-fieldfile input position7
vertical-align middle margin-top7
middle margin-top -5px7
margin-top -5px margin-bottom7
-5px margin-bottom -5px7
plp-fieldfile span display7
span display inline-block7
vertical-align middle line-height7
middle line-height 17
inputfocus bgimage tick7
cursor pointer position7
plp-fieldcheckbox-visual inputfocus bgimage7
pointer z-index 07
plp-fieldfile clean float7
clean float right7
float right opacity7
right opacity 057
opacity 05 cursor7
05 cursor pointer7
flexgridalign-sides left name7
border-radius 100px opacity7
plp-fieldcheckbox-visual bgimage background-size7
05 border 1px7
auto line-height 127
line-height 12 box-shadow7
12 box-shadow none7
box-shadow none position7
none position relative7
position relative background-color7
relative background-color rgb2457
background-color rgb245 2457
rgb245 245 2457
245 245 color7
245 color rgba07
color rgba0 07
0 0 057
0 05 border7
border 1px none7
form-control height auto7
96px font-size 14px7
form-control form-control margin-top7
rgb242 242 2427
background-color rgb242 2427
3 background-color rgb2427
form-controlfocus-within border-color rgb2267
font-size 14px cursor7
12px 96px font-size7
1px none rgba07
padding 12px 96px7
5px padding 12px7
border-radius 5px padding7
025 border-radius 5px7
0 025 border-radius7
none rgba0 07
height auto line-height7
normal letter-spacing none7
label font-weight normal7
cover background-repeat no-repeat7
24pxfont-size 14pxcolor rgb2557
0 2padding-top 10pxpadding-bottom7
2padding-top 10pxpadding-bottom 10pxpadding-left7
padding-right 0important screen-xs7
10pxpadding-bottom 10pxpadding-left 20pxpadding-right7
10pxpadding-left 20pxpadding-right 20pxfont-size7
background-repeat no-repeat color7
padding-bottom 14px font-size7
no-repeat color fff7
wrapper2 padding-right 5pximportant7
plp-fieldcheckbox-visual label position7
0px rgba226 07
12pxfont-size 16pxfont-weight boldcolor7
12pxpadding-right 12pxfont-size 16pxfont-weight7
plp-field padding-bottom 14px7
14px font-size 14px7
text-transform normal letter-spacing7
08 margin-bottom 7px7
break-word text-transform normal7
word-wrap break-word text-transform7
14px word-wrap break-word7
font-size 14px word-wrap7
7px font-size 14px7
margin-bottom 7px font-size7
opacity 08 margin-bottom7
font-size 14px font-family7
roboto opacity 087
font-family roboto opacity7
normal font-family roboto7
font-weight normal font-family7
name font-weight normal7
14px font-family roboto7
form-control margin-top 10px7
14px cursor initial7
font-weight normal display7
white border-radius 100px7
height 22px min-height7
22px min-height auto7
all border-radius 100px7
radiobefore position absolute7
width 100 top7
normal display block7
top 0 height7
0 height 1007
height 100 content7
100 content display7
content display block7
display block background-color7
block background-color white7
background-color white border-radius7
100px opacity 07
line-height 0 width7
1 transform scale057
plp-fieldcheckbox-visual item display7
plp-fieldcheckbox-visual items display7
plp-fieldcheckbox-visual overflow hidden7
plp-fieldcheckbox-list label label7
plp-fieldcheckbox-list input position7
plp-fieldcheckbox-list span vertical-align7
radiobefore opacity 17
inputfocus radio border-color7
inputchecked radiobefore opacity7
radio border-color rgb2037
inputchecked radio border-color7
radio box-shadow inset7
inputactive radio box-shadow7
radio border-color rgb2557
0 width 22px7
100 top 07
height 22px padding7
width 100 opacity7
22px padding 07
padding 0 margin7
0 0 line-height7
line-height 0 min-height7
textarea resize vertical7
padding 0 line-height7
block cursor pointer7
display block cursor7
0 min-height auto7
checkbox width 22px7
checkbox svg width7
svg width 1007
all border-radius 2px7
inputfocus checkbox border-color7
radio margin 07
inputchecked checkbox border-color7
checkbox border-color rgb2037
0 padding 07
inputactive checkbox box-shadow7
checkbox box-shadow inset7
inputchecked checkbox svg7
0 0 padding7
margin 0 margin7
checkbox svg opacity7
checkbox border-color rgb2557
1 transform scale17
rgb40 40 40padding-top6
overflow hidden node160meta6
5pximportant padding-left 5pximportant6
overflow hidden node159meta6
padding-right 5pximportant padding-left6
overflow hidden node156meta6
overflow hidden node155meta6
40padding-top 6pxpadding-bottom 6pxpadding-left6
16pxfont-weight boldcolor rgb406
rgb255 255 255border-color6
255 255 06
0border-color rgb226 06
255 0border-color rgb2266
255 255 0border-color6
255border-color rgb226 06
255 255border-color rgb2266
40 40font-family roboto6
rgb40 40 40font-family6
boldcolor rgb40 406
overflow hidden node158meta6
overflow hidden node157meta6
40 40padding-top 6pxpadding-bottom6
padding-bottom 50pximportant padding-left6
255 0border-top-left-radius 0pxborder-top-right-radius6
100important padding-left 10pximportant6
padding-top 50pximportant padding-bottom6
s-elements-gridcellwrapper padding-top 50pximportant6
0pxborder-color rgb40 406
50pximportant padding-bottom 50pximportant6
10pximportant padding-right 10pximportant6
50pximportant padding-left 0important6
padding-left 10pximportant padding-right6
0pxborder-right-width 0pxborder-color rgb406
255 255 0border-top-left-radius6
12pxfont-size 14pxcolor rgb06
overflow hidden node154meta6
padding-right 0 node1765
padding-left 15pximportant padding-right5
vertical-align middle node155meta5
repeat color fff5
background-repeat repeat color5
cover background-repeat repeat5
padding-top 225pximportant padding-bottom5
s-elements-gridcellwrapper padding-top 225pximportant5
15pximportant screen-xs node1765
padding-right 15pximportant screen-xs5
15pximportant padding-right 15pximportant5
0 padding-right 15px5
100important padding-left 15pximportant5
15px padding-right 05
225px padding-bottom 225px5
nbspnbsp nbsp nbsp5
padding-bottom 225px padding-left5
225pximportant padding-bottom 225pximportant5
background-attachment fixed background-position5
wrapper1 background-attachment fixed5
background-attachment scrollimportant screen-sm5
width 50 padding-left5
padding-top 225px padding-bottom5
s-elements-gridcellwrapper padding-top 225px5
padding-left 15px padding-right5
vertical-align middle node156meta5
padding-bottom 225pximportant padding-left5
rectfillnone fill none5
vertical-align middle node154meta5
s-elements-gridcellcell-1 s-elements-gridcellwrapper padding-top5
s-elements-gridcellcell-2 s-elements-gridcellwrapper padding-top5
100important screen-xs node2075
width 100important screen-xs5
width 33333333333333336 node2075
s-elements-gridcellcell-0 s-elements-gridcellwrapper padding-top5
vertical-align middle node159meta5
white color 3335
background-color white color5
wrapper1 background-color white5
path fill none5
vertical-align middle node160meta5
right font-size 1005
rect fill rgb2265
225pximportant padding-left 0important5
vertical-align middle node158meta5
vertical-align middle node157meta5
defs path fill5
fill rgb226 05
cursor pointer node160meta4
cursor pointer node155meta4
opacity 0 node159meta4
cursor pointer node154meta4
opacity 0 node155meta4
opacity 0 node154meta4
wrapper1 background-position center4
opacity 0 node158meta4
cursor pointer node157meta4
cursor pointer node159meta4
cursor pointer node156meta4
opacity 0 node157meta4
cursor pointer node158meta4
opacity 0 node156meta4
opacity 0 node160meta4
md else if4
rgb230 130 254
uppercasecolor rgb255 2554
fixed background-position center4
4px 10px 0px4
10px 0px rgba2264
0important screen-xs node1764
255box-shadow 0px 4px4
text-transform uppercasecolor rgb2554
lg else if4
01em text-transform uppercasecolor4
14pxletter-spacing 01em text-transform4
20pxfont-size 14pxletter-spacing 01em4
20pxpadding-right 20pxfont-size 14pxletter-spacing4
left center background-size4
background-position left center4
padding-right 15px node1764
0px 4px 10px4
0 3 054
color rgb230 1304
else if plpscreens4
plpscreen lg else4
s-elements-gridcellcell-0 width 100important4
plpscreen md else4
s-elements-gridcellcell-1 width 100important4
s-elements-gridcellcell-2 width 100important4
padding height 100px4
background-color rgb255 04
padding-right 35px padding-bottom3
wrapper1 background-position left3
screen-xs node160meta plp-fieldcheckbox-visual3
1 node160meta plp-fieldfile3
padding-right 25px padding-bottom3
screen-xs node160meta plp-fieldradio-visual3
align-items center node160meta3
text-align center node159meta3
bgimage tick node160meta3
documentbodyclientwidth 992 documentbodyclientwidth3
center node160meta plp-fieldresult3
50 padding-left 15px3
1200 plpscreen lg3
nbsp nbsp nbspnbsp3
documentbodyclientwidth 1200 plpscreen3
if documentbodyclientwidth 12003
992 plpscreen md3
documentbodyclientwidth 992 plpscreen3
if documentbodyclientwidth 9923
225px padding-left 03
text-align center node160meta3
1 node159meta plp-fieldfile3
node167 wrapper1 background-attachment3
documentbodyclientwidth 768 documentbodyclientwidth3
nbsp nbspnbsp nbsp3
0 3 043
15px 0px rgba2263
5px 15px 0px3
0px 5px 15px3
center node159meta plp-fieldresult3
text-align center node154meta3
align-items center node159meta3
width 33333333333333336 padding-left3
padding-right 10px node543
padding-bottom 50px padding-left3
50px padding-bottom 50px3
padding-top 50px padding-bottom3
s-elements-gridcellwrapper padding-top 50px3
node54 s-elements-gridcellcell-0 s-elements-gridcellwrapper3
padding-left 10px padding-right3
node54 s-elements-gridcellcell-0 width3
node54 s-elements-gridcellcell-1 s-elements-gridcellwrapper3
node76 wrapper1 wrapper23
node70 wrapper1 wrapper23
center node154meta plp-fieldresult3
padding-left 5pximportant screen-md3
node64 wrapper1 wrapper23
node34 wrapper1 background-attachment3
node51 wrapper1 background-attachment3
node54 s-elements-gridcellcell-1 width3
node54 s-elements-gridcellcell-2 width3
25 25 screen-xs3
wrapper1 background-color rgb403
bgimage tick node154meta3
screen-xs node154meta plp-fieldcheckbox-visual3
screen-xs node154meta plp-fieldradio-visual3
40 color fff3
40 40 color3
rgb40 40 403
background-color rgb40 403
24pxfont-size 14pxcolor rgb03
1 node154meta plp-fieldfile3
align-items center node154meta3
12pxfont-size 14pxcolor rgb2553
10pximportant screen-xs node543
padding-right 10pximportant screen-xs3
0important screen-xs node543
10pximportant screen-sm node543
padding-right 10pximportant screen-sm3
node54 s-elements-gridcellcell-2 s-elements-gridcellwrapper3
node45 wrapper1 background-attachment3
undefinedpx padding-left undefinedpx3
screen-xs node159meta plp-fieldradio-visual3
bgimage tick node158meta3
bgimage tick node157meta3
screen-xs node157meta plp-fieldcheckbox-visual3
screen-xs node157meta plp-fieldradio-visual3
align-items center node157meta3
1 node157meta plp-fieldfile3
center node157meta plp-fieldresult3
text-align center node157meta3
screen-xs node158meta plp-fieldcheckbox-visual3
center node156meta plp-fieldresult3
screen-xs node158meta plp-fieldradio-visual3
align-items center node158meta3
1 node158meta plp-fieldfile3
center node158meta plp-fieldresult3
text-align center node158meta3
bgimage tick node159meta3
screen-xs node159meta plp-fieldcheckbox-visual3
text-align center node156meta3
1 node156meta plp-fieldfile3
padding-bottom undefinedpx padding-left3
bgimage tick node155meta3
undefinedpx padding-bottom undefinedpx3
padding-right undefinedpx padding-bottom3
undefinedpx padding-right undefinedpx3
padding-top undefinedpx padding-right3
node40 wrapper1 background-attachment3
padding-top 0px padding-bottom3
background-color rgb230 2303
screen-xs node155meta plp-fieldcheckbox-visual3
align-items center node156meta3
screen-xs node155meta plp-fieldradio-visual3
align-items center node155meta3
1 node155meta plp-fieldfile3
center node155meta plp-fieldresult3
text-align center node155meta3
bgimage tick node156meta3
screen-xs node156meta plp-fieldcheckbox-visual3
screen-xs node156meta plp-fieldradio-visual3
nbsp 7 4953
wrapper1 wrapper2196
wrapper2 padding-top175
color rgb230171
0 0169
wrapper1 color166
rgb230 25159
rgb255 255143
color 333125
0 3113
rgba0 0112
5px padding-bottom111
padding-left 5px111
padding-right 5px111
25 28104
5px padding-left103
padding-bottom 5px103
5px padding-right102
padding-top 5px102
255 255101
vertical-align middle99
opacity 098
rgb226 096
position absolute95
rgb203 095
0 02590
nbsp nbsp88
0 2color82
background-color rgb20381
width 10071
0px rgba070
5px 0px69
0px 2px69
2px 5px69
fa font-size67
display inline-block65
color fff62
position relative62
2color rgb25562
0 3border-color60
overflow hidden56
25 2555
rgb181 055
background-color rgb22654
0 2padding-top53
rgb145 053
255 255box-shadow52
rgb163 049
cursor pointer49
inline-block vertical-align49
0 height49
0 opacity49
input position49
bgimage tick49
padding-bottom 0px48
inset 0px48
0px padding-bottom46
padding-left 0px45
text-align center44
padding-top 0px43
0px padding-left43
padding-right 0px43
0 width43
word-wrap break-word42
0 242
height 042
width 042
absolute width42
0px padding-right40
opacity 138
rgba226 037
0 3border-top-left-radius37
0pxborder-bottom-width 0pxborder-left-width36
3border-color rgb14536
solidborder-top-width 0pxborder-bottom-width36
0pxborder-left-width 0pxborder-right-width36
0pxborder-right-width 0pxborder-color36
svg opacity35
display flex35
height 10035
top 035
absolute left35
left 035
opacity 0535
2padding-top 8pxpadding-bottom34
8pxpadding-bottom 8pxpadding-left34
0pxborder-color rgb18130
background-color rgba22630
background-color rgba18330
rgba183 030
rgb0 029
span vertical-align28
300ms all28
transition 300ms28
0 overflow28
100 height28
transition all28
all 300ms28
inputchecked bgimage28
255box-shadow 0px28
tick svg28
rgb183 026
background-size cover26
background-color rgb18326
1pxborder-right-width 1pxborder-color24
solidborder-top-width 1pxborder-bottom-width24
5pxborder-style solidborder-top-width24
font-size 18px24
5pxborder-bottom-left-radius 5pxborder-style24
5pxborder-bottom-right-radius 5pxborder-bottom-left-radius24
5pxborder-top-right-radius 5pxborder-bottom-right-radius24
margin 024
255box-shadow inset24
1pxcolor rgb25523
8pxpadding-left 16pxpadding-right23
font-size 23px23
1pxborder-color rgb18123
3pxborder-bottom-width 1pxcolor23
3border-top-left-radius 5pxborder-top-right-radius23
1pxborder-bottom-width 3pxborder-left-width23
2border-top-width 3pxborder-bottom-width23
3pxborder-left-width 1pxborder-right-width23
18pxcolor rgb25523
16pxfont-size 18pxcolor23
16pxpadding-right 16pxfont-size23
0 2border-top-width23
nbsp whatsapp22
3border-color rgb16322
3box-shadow inset22
background-position center22
0 3box-shadow22
font-size 14px22
right text-align21
text-align right21
font-size 8021
flex-grow 121
0border-top-left-radius 0pxborder-top-right-radius21
0pxborder-top-right-radius 0pxborder-bottom-right-radius21
align-items center21
flex align-items21
3 background-color21
line-height 021
100 opacity21
text-align left21
0pxborder-bottom-right-radius 0pxborder-bottom-left-radius21
0pxborder-bottom-left-radius 0pxborder-style21
0pxborder-style solidborder-top-width21
1 min-width21
2color rgb019
background-color rgba25519
display block19
s-elements-gridcellwrapper padding-top19
rgba255 25519
12pxpadding-right 12pxfont-size19
6pxpadding-left 12pxpadding-right18
6pxpadding-bottom 6pxpadding-left18
width 100important17
top 5017
node158meta plp-fieldcheckbox-visual16
node154meta plp-fieldcheckbox-visual16
node160meta plp-fieldcheckbox-visual16
background-color rgb25516
node157meta plp-fieldcheckbox-visual16
node159meta plp-fieldcheckbox-visual16
rgb40 4016
border 2px16
2px solid16
color rgb2516
center margin-bottom16
node156meta plp-fieldcheckbox-visual16
node155meta plp-fieldcheckbox-visual16
border-radius 100px15
node157meta plp-fieldradio-visual15
3 0border-top-left-radius15
node155meta plp-fieldradio-visual15
absolute top15
background-color rgba20315
3 0border-color15
0border-color rgb14515
node158meta plp-fieldradio-visual15
wrapper1 background-attachment15
rgba203 015
node156meta plp-fieldradio-visual15
node160meta plp-fieldradio-visual15
0border-color rgb16315
2 015
100 text-align15
node159meta plp-fieldradio-visual15
0 transform15
border-color rgb25515
node154meta plp-fieldradio-visual15
2 0border-color15
0 5px14
inputhover bgimage14
inset 014
radio border-color14
checkbox border-color14
z-index 114
pointer z-index14
0 cursor14
break-word white-space14
0 left14
plp-fieldradio-visual inputchecked14
tick opacity14
plp-fieldradio-visual subname14
white-space normal14
min-width 5014
0 word-wrap14
50 word-wrap14
25pxborder-bottom-left-radius 25pxborder-style14
1 transform14
translate-50 -5014
font-family roboto14
plp-fieldcheckbox-visual subname14
font-weight normal14
plp-fieldradio-visual bgimage14
5px rgba014
0 01514
subname margin14
margin 7px14
7px 014
flexgrid display14
plp-fieldselect-menu flexgrid14
plp-fieldradio-visual tick14
10px white-space14
plp-fieldcheckbox-visual inputchecked14
relative transition14
auto display14
middle background14
background white14
white border14
inputchecked checkbox14
solid rgba014
nowrap screen-xs14
025 position14
item width14
padding-top 2514
all border-radius14
25 padding-top14
checkbox svg14
113 11514
rgb255 11314
svg width14
transform scale014
scale0 transition14
width 2514
min-height auto14
border-color rgb20314
plp-fieldradio-visual item14
width 7514
box-shadow inset14
bgimage width14
1 screen-xs14
margin-left -4px14
5 margin-left14
padding-left 514
middle padding-left14
75 display14
subname width14
0 line-height14
middle screen-xs14
white-space nowrap14
22px height14
height 22px14
25 vertical-align14
padding 014
0 margin14
0 55px14
55px 014
width 22px14
margin-bottom 10px14
25pxborder-style solidborder-top-width14
label position14
hidden position14
50px overflow14
border-radius 50px14
center border-radius14
inline-block background-position14
cover display14
bgimage background-size14
plp-fieldcheckbox-visual bgimage14
26px position14
100 padding-top14
width 3014
20px width14
plp-fieldresult flexgridalign-right14
left text-align14
margin-bottom 20px14
plp-fieldresult flexgridalign-center14
top text-align14
item display14
plp-fieldcheckbox-visual item14
relative width14
padding-top 10014
plp-fieldresult flexgridalign-sides14
25pxborder-top-right-radius 25pxborder-bottom-right-radius14
300ms opacity14
075 transition14
3 07514
100 background-color14
inherit cursor14
color inherit14
dashed color14
25pxborder-bottom-right-radius 25pxborder-bottom-left-radius14
3border-top-left-radius 25pxborder-top-right-radius14
max-width 26px14
border-bottom-style dashed14
1px border-bottom-style14
border-bottom-width 1px14
none border-bottom-width14
text-decoration none14
0 top14
tick position14
plp-fieldcheckbox-visual tick14
300ms max-width14
justify-content space-between14
vertical-align top14
50 top14
margin-bottom -20px14
50 transform14
label label14
label margin-top14
margin-top 7333333333333333px14
left 5014
0 transition14
transform translate-5014
0 2border-color14
items display14
flex flex-wrap14
wrap margin-bottom14
plp-fieldfile flexgrid14
flex-wrap wrap14
left margin-bottom14
-20px justify-content14
0 3color13
rgb25 8312
2border-color rgb16312
83 23012
cover background-repeat12
background-color white12
wrapper2 background-color12
3color rgb22612
center background-size12
else if11
padding-left 10px11
padding-right 10px11
padding-top 2px11
padding-left 0important11
padding-right 0important11
2px padding-right11
100important padding-left11
0important padding-right11
2padding-top 6pxpadding-bottom11
fill none10
8pxpadding-left 24pxpadding-right10
24pxfont-size 14pxcolor10
screen-xs node17610
12pxfont-size 14pxcolor10
24pxpadding-right 24pxfont-size10
14pxcolor rgb25510
background-attachment scrollimportant10
0 padding-right9
14pxcolor rgb09
font-size 21px9
wrapper1 background-color9
width 333333333333333369
node159meta plp-fieldresult8
if documentbodyclientwidth8
padding-left 08
border-color rgb2268
10px padding-bottom8
node158meta plp-fieldresult8
165 258
rgb230 1658
padding-bottom 14px8
padding-right 08
height 20px8
node154meta plp-fieldresult8
wrapper2 padding-right8
node157meta plp-fieldresult8
node155meta plp-fieldresult8
node156meta plp-fieldresult8
center center8
none position8
node160meta plp-fieldresult8
inputfocus bgimage7
plp-fieldcheckbox-visual inputfocus7
plp-fieldcheckbox-visual inputhover7
whatsapp nbsp7
plp-fieldselect-menu select7
node159meta plp-fieldfile7
name margin-bottom7
min-width 257
right flex-grow7
flexgrid right7
plp-fieldresult flexgrid7
flexgridalign-right left7
flexgridalign-center left7
margin-bottom 07
left name7
break-word text-align7
flexgridalign-sides left7
flexgridalign-sides display7
center flex-grow7
flexgrid center7
cleanhover opacity7
plp-fieldfile cleanhover7
relative z-index7
pointer position7
25 word-wrap7
right font-size7
float right7
plp-fieldprivacy-checkbox font-size7
node155meta plp-fieldfile7
opacity 0257
plp-fieldhidden opacity7
80 text-align7
plp-fieldprivacy-text font-size7
plp-fieldprivacy-checkbox input7
middle text-decoration7
plp-fieldprivacy-checkbox span7
80 cursor7
plp-fieldresult flexgridalign-left7
node156meta plp-fieldfile7
05 font-size7
center opacity7
open text-align7
plp-fieldprivacy-button open7
flexgridalign-right right7
flexgridalign-center right7
flexgridalign-left right7
05 cursor7
clean float7
wrapper1 background-position7
plp-fieldradio-visual input7
plp-fieldselect-menu fa7
-webkit-appearance none7
black -webkit-appearance7
color black7
1 color7
select position7
plp-fieldradio-visual inputhover7
plp-fieldradio-visual label7
20px line-height7
plp-fieldradio-visual items7
plp-fieldradio-visual overflow7
plp-fieldradio-list label7
plp-fieldradio-list input7
plp-fieldradio-list span7
plp-fieldcheckbox-input input7
plp-fieldcheckbox-input span7
node160meta plp-fieldfile7
font-size 20px7
05 vertical-align7
plp-fieldfile clean7
margin-top -5px7
z-index 07
plp-fieldfile input7
line-height 17
middle line-height7
span display7
plp-fieldfile span7
margin-bottom -5px7
-5px margin-bottom7
middle margin-top7
node158meta plp-fieldfile7
20px vertical-align7
node157meta plp-fieldfile7
20px height7
width 20px7
plp-fieldfile svg7
node154meta plp-fieldfile7
left flex-grow7
flexgrid left7
right opacity7
plp-fieldcheckbox-list span7
rgb245 2457
05 border7
line-height 127
12 box-shadow7
box-shadow none7
relative background-color7
background-color rgb2457
0px rgba2267
245 2457
245 color7
color rgba07
0 057
border 1px7
height auto7
1px none7
none rgba07
025 border-radius7
border-radius 5px7
5px padding7
padding 12px7
10pxpadding-bottom 10pxpadding-left7
96px font-size7
14px cursor7
cursor initial7
auto line-height7
form-control height7
background-color rgb2427
14px font-family7
s-elements-gridcellcell-2 width7
2padding-top 10pxpadding-bottom7
10pxpadding-left 20pxpadding-right7
20pxpadding-right 20pxfont-size7
s-elements-gridcellcell-0 width7
0important screen-xs7
background-repeat no-repeat7
no-repeat color7
plp-field padding-bottom7
14px font-size7
name font-weight7
letter-spacing none7
normal font-family7
roboto opacity7
opacity 087
08 margin-bottom7
margin-bottom 7px7
7px font-size7
14px word-wrap7
break-word text-transform7
text-transform normal7
normal letter-spacing7
form-controlfocus-within border-color7
12px 96px7
rgb242 2427
inputactive radio7
100 top7
100 content7
content display7
242 2427
block background-color7
white border-radius7
100px opacity7
inputhover radio7
inputfocus radio7
radio box-shadow7
plp-fieldcheckbox-visual input7
inputchecked radio7
inputchecked radiobefore7
radiobefore opacity7
transform scale057
plp-fieldcheckbox-list input7
padding-right 5pximportant7
plp-fieldcheckbox-list label7
plp-fieldcheckbox-visual overflow7
plp-fieldcheckbox-visual items7
plp-fieldcheckbox-visual label7
radiobefore position7
s-elements-gridcellcell-1 width7
22px min-height7
22px padding7
label font-weight7
normal display7
margin-top 10px7
0 padding7
block cursor7
12pxfont-size 16pxfont-weight7
textarea resize7
resize vertical7
form-control margin-top7
checkbox width7
0 min-height7
form-control form-control7
border-radius 2px7
inputhover checkbox7
inputfocus checkbox7
16pxfont-weight boldcolor7
inputactive checkbox7
checkbox box-shadow7
transform scale17
radio margin7
center node157meta6
center node158meta6
screen-xs node158meta6
0 node158meta6
hidden node158meta6
screen-xs node156meta6
screen-xs node157meta6
0 node157meta6
hidden node157meta6
15px padding-right6
center node156meta6
hidden node155meta6
hidden node156meta6
0 node155meta6
center node155meta6
0 node156meta6
0 node154meta6
hidden node159meta6
40font-family roboto6
nbspnbsp nbsp6
255 0border-top-left-radius6
0pxborder-color rgb406
40 40padding-top6
documentbodyclientwidth 9926
40padding-top 6pxpadding-bottom6
boldcolor rgb406
padding-left 5pximportant6
screen-xs node2076
40 40font-family6
padding height6
0 node159meta6
255 255border-color6
255border-color rgb2266
255 0border-color6
0border-color rgb2266
255 06
center node160meta6
screen-xs node160meta6
0 node160meta6
hidden node160meta6
center node159meta6
screen-xs node159meta6
5pximportant padding-left6
screen-xs node155meta6
screen-sm node546
50pximportant padding-left6
screen-xs node154meta6
node54 s-elements-gridcellcell-16
padding-left 10pximportant6
10pximportant padding-right6
padding-right 10pximportant6
padding-top 50pximportant6
50pximportant padding-bottom6
padding-bottom 50pximportant6
hidden node154meta6
center node154meta6
screen-xs node546
node54 s-elements-gridcellcell-06
node54 s-elements-gridcellcell-26
s-elements-gridcellcell-1 s-elements-gridcellwrapper5
225pximportant padding-left5
padding-bottom 225pximportant5
middle node158meta5
225pximportant padding-bottom5
33333333333333336 node2075
padding-left 15px5
padding-top 225pximportant5
middle node157meta5
scrollimportant screen-sm5
15pximportant screen-xs5
100important screen-xs5
font-size 1005
padding-right 15pximportant5
background-attachment fixed5
50 padding-left5
15pximportant padding-right5
padding-top 225px5
width 505
rectfillnone fill5
path fill5
defs path5
fill rgb2265
rect fill5
0 node1765
225px padding-bottom5
middle node159meta5
padding-bottom 225px5
225px padding-left5
padding-right 15px5
background-color rgb2305
middle node160meta5
white color5
padding-left 15pximportant5
s-elements-gridcellcell-2 s-elements-gridcellwrapper5
fixed background-position5
s-elements-gridcellcell-0 s-elements-gridcellwrapper5
node34 wrapper15
repeat color5
middle node154meta5
background-repeat repeat5
nbsp 75
if plpscreens5
middle node155meta5
middle node156meta5
pointer node155meta4
130 254
nbsp nbspnbsp4
20pxfont-size 14pxletter-spacing4
documentbodyclientwidth 7684
node155meta inputchecked4
rgb230 1304
text-transform uppercasecolor4
25px padding-bottom4
uppercasecolor rgb2554
node159meta inputchecked4
pointer node159meta4
node158meta plp-fieldprivacy-checkbox4
node159meta plp-fieldselect-menu4
node159meta plp-fieldprivacy-checkbox4
s-elements-gridcellcell-4 width4
node176 s-elements-gridcellcell-34
height 2px4
node160meta plp-fieldselect-menu4
15px node1764
node51 wrapper14
node176 s-elements-gridcellcell-14
node176 s-elements-gridcellcell-24
rgb230 2304
node176 s-elements-gridcellcell-44
node45 wrapper14
01em text-transform4
s-elements-gridcellcell-3 width4
node160meta inputchecked4
pointer node160meta4
0px 4px4
node154meta inputchecked4
node158meta plp-fieldselect-menu4
lg else4
node157meta inputchecked4
background-position left4
left center4
node156meta inputchecked4
10px 0px4
node64 wrapper14
node176 s-elements-gridcellcell-04
pointer node157meta4
node157meta plp-fieldselect-menu4
node156meta plp-fieldprivacy-checkbox4
3 054
14pxletter-spacing 01em4
node154meta plp-fieldselect-menu4
node70 wrapper14
node76 wrapper14
node156meta plp-fieldselect-menu4
pointer node156meta4
node155meta plp-fieldprivacy-checkbox4
plpscreen lg4
rgb255 04
node160meta plp-fieldprivacy-checkbox4
node155meta plp-fieldselect-menu4
4px 10px4
md else4
plpscreen md4
node167 wrapper14
height 100px4
pointer node154meta4
node40 wrapper14
35px padding-bottom4
node158meta inputchecked4
pointer node158meta4
node157meta plp-fieldprivacy-checkbox4
25 screen-xs4
node154meta plp-fieldprivacy-checkbox4
node154meta plp-fieldcheckbox-list3
tick node154meta3
node291meta goup3
992 documentbodyclientwidth3
padding-left 35px3
node291 wrapper13
container width3
containersoft max-width3
padding-right 25px3
40 color3
40 403
padding-right 35px3
768 documentbodyclientwidth3
background-color rgb403
node154meta plp-fieldradio-list3
992 plpscreen3
10pximportant screen-xs3
documentbodyclientwidth 12003
1200 plpscreen3
5pximportant screen-md3
tick node159meta3
3 043
tick node155meta3
1 node156meta3
60px padding-bottom3
node156meta plp-fieldradio-list3
tick node156meta3
100 node156meta3
padding-top undefinedpx3
node156meta plp-fieldcheckbox-list3
undefinedpx padding-right3
1 node155meta3
padding-right undefinedpx3
undefinedpx padding-bottom3
node155meta plp-fieldradio-list3
padding-bottom undefinedpx3
100 node157meta3
node155meta plp-fieldcheckbox-list3
undefinedpx padding-left3
padding-left undefinedpx3
node34inner s-slider1-previous3
node34inner s-slider1-next3
node34inner s-slider1-arrow-left-anglebefore3
node34inner s-slider1-arrow-left-angleafter3
node34inner s-slider1-arrow-right-anglebefore3
node34inner s-slider1-arrow-right-angleafter3
screen-xs node34inner3
display none3
padding-bottom 61px3
node157meta plp-fieldcheckbox-list3
33333333333333336 padding-left3
15px 0px3
100 node159meta3
5px 15px3
0px 5px3
1 node160meta3
1 node154meta3
node160meta plp-fieldradio-list3
tick node160meta3
10pximportant screen-sm3
100 node160meta3
node160meta plp-fieldcheckbox-list3
node14 wrapper13
1 node159meta3
node159meta plp-fieldradio-list3
node159meta plp-fieldcheckbox-list3
tick node157meta3
1 node158meta3
10px node543
50px padding-left3
node158meta plp-fieldradio-list3
padding-bottom 50px3
tick node158meta3
50px padding-bottom3
100 node158meta3
padding-top 50px3
node158meta plp-fieldcheckbox-list3
1 node157meta3
node157meta plp-fieldradio-list3
10px padding-right3
7 4953
01186
5px521
color406
wrapper1393
0px338
background-color318
1263
2261
padding-left234
padding-top234
padding-right222
width219
padding-bottom213
wrapper2196
opacity187
rgb230177
rgb255161
position158
nbsp129
3126
4125
display122
height120
font-size117
5115
vertical-align113
plp-fieldcheckbox-visual112
rgba0112
2px111
center106
plp-fieldradio-visual105
left105
6104
middle99
02598
rgb22696
absolute95
rgb20395
node160meta88
node154meta88
node158meta88
node159meta88
node157meta88
node156meta88
node155meta88
text-align86
2color82
780
bgimage77
tick77
screen-xs77
top68
fa67
inline-block65
margin-bottom65
inset62
fff62
relative62
3border-color60
right60
solidborder-top-width60
transition57
overflow56
plp-fieldresult56
cursor56
300ms56
inputchecked56
none56
all56
hidden56
rgb18155
2padding-top53
rgb14553
10px52
255box-shadow52
850
svg49
plp-fieldfile49
label49
rgb16349
pointer49
input49
checkbox49
0547
border-radius45
transform44
943
word-wrap42
break-word42
20px40
margin38
border-color37
3border-top-left-radius37
rgba22637
0pxborder-bottom-width36
0pxborder-left-width36
0pxborder-right-width36
0border-color36
0pxborder-color36
line-height35
radio35
span35
flexgrid35
flex35
normal35
8pxpadding-bottom34
node34inner34
margin-top34
8pxpadding-left34
padding30
rgba18330
22px30
14px30
rgb029
subname28
plp-fieldprivacy-checkbox28
item28
white-space28
plp-fieldselect-menu28
inputhover28
18px27
background-position26
white26
cover26
background-size26
rgb18326
23px25
1pxborder-right-width24
5pxborder-style24
5pxborder-bottom-left-radius24
5pxborder-bottom-right-radius24
5pxborder-top-right-radius24
1pxborder-color24
1pxborder-bottom-width24
min-width24
node17624
1pxcolor23
3pxborder-left-width23
whatsapp23
16pxpadding-right23
16pxfont-size23
18pxcolor23
border23
2border-top-width23
3pxborder-bottom-width23
box-shadow22
1px22
node5422
3box-shadow22
0important22
roboto22
z-index22
0border-top-left-radius21
plp-fieldcheckbox-list21
0pxborder-style21
1021
7px21
1121
inputfocus21
auto21
plp-fieldradio-list21
0pxborder-top-right-radius21
flex-grow21
0pxborder-bottom-left-radius21
0pxborder-bottom-right-radius21
form-control21
align-items21
100px20
14pxcolor20
50px20
1219
s-elements-gridcellwrapper19
max-width19
rgba25519
12pxpadding-right19
block19
12pxfont-size19
solid18
if18
6pxpadding-left18
6pxpadding-bottom18
100important17
margin-left17
rgb2516
-5px16
rgb4016
rgba20315
border-bottom-style15
background-attachment15
border-bottom-width15
07515
text-decoration15
fill15
15px15
node20715
2border-color14
scale014
nowrap14
1314
1414
-4px14
plp-fieldcheckbox-input14
justify-content14
1514
1614
plp-fieldprivacy-text14
inherit14
dashed14
background14
min-height14
flexgridalign-sides14
flexgridalign-center14
flexgridalign-right14
1714
25pxborder-style14
1814
-20px14
wrap14
name14
flex-wrap14
font-weight14
items14
font-family14
7333333333333333px14
space-between14
1914
2014
documentbodyclientwidth14
26px14
translate-5014
radiobefore14
25pxborder-top-right-radius14
25pxborder-bottom-right-radius14
25pxborder-bottom-left-radius14
01514
inputactive14
55px14
5pximportant13
3color13
2112
50pximportant12
s-elements-gridcellcell-012
else12
background-repeat12
screen-sm12
s-elements-gridcellcell-112
10pximportant12
s-elements-gridcellcell-212
undefinedpx12
12px11
plpscreen11
text-transform11
21px11
scrollimportant10
24pxpadding-right10
225pximportant10
15pximportant10
225px10
24pxfont-size10
path10
svg869
svg909
svg949
svg989
svg1029
229
content9
239
nbspnbsp9
248
25px8
35px8
20pxfont-size7
96px7
initial7
form-controlfocus7
form-controlfocus-within7
rgb2427
textarea7
resize7
vertical7
-webkit-appearance7
flexgridalign-left7
plp-fieldprivacy-button7
black7
open7
select7
10pxpadding-bottom7
20pxpadding-right7
scale17
scale057
rgb2457
no-repeat7
257
087
10pxpadding-left7
16pxfont-weight7
boldcolor7
cleanhover7
plp-field7
float7
clean7
plp-fieldhidden7
letter-spacing7
266
40padding-top6
s-elements-gridcellcell-36
s-elements-gridcellcell-46
255border-color6
40font-family6
fixed6
node346
polygonfillnone5
275
rectfillnone5
node226meta5
node645
plpscreens5
node291meta5
polygon5
repeat5
node515
60px5
defs5
node705
node1675
node455
circle5
rect5
node765
node405
pathfillnone5
circlefillnone5
8px4
container4
284
24px4
294
node2914
node2224
node144
node794
node2204
304
node2154
node684
lg4
md4
4px4
uppercasecolor4
01em4
node2134
14pxletter-spacing4
node2244
node1494
node2174
node2123
node2013
313
node2023
node2143
node2273
node2163
node2183
node2193
divareascreen-sm3
node2213
containersoft3
divareascreen-md3
750px3
970px3
node2253
node2343
node2923
1170px3
node2423
node2603
node2593
node2583
node2573
node2563
node2553
node2543
node2523
node2513
node2283
node2453
node2463
node2443
node2643
node2433
node2413
node2403
node2393
node2383
node2293
node2303
node2373
node2313
node2323
node2333
node2363
node2533
node2653
divareascreen-lg3
node2843
node3263
node3253
node2993
node2233
goup3
node2933
node2353
node2263
node2803
node2873
node2863
node2853
node2833
node2673
node2823
node2813
node2793
node2783
node2663
node2743
node2733
node2723
node1973
node2703
node2693
node2683
node2713
f3
node1993
node633
s-slider1-previous3
s-slider1-next3
s-slider1-arrow-left-anglebefore3
s-slider1-arrow-left-angleafter3
s-slider1-arrow-right-anglebefore3
s-slider1-arrow-right-angleafter3
s-slider1-page3
61px3
node553
node563
node623
screen-md3
section-slider-container3
node653
node613
node693
node713
node673
node743
node753
16px3
node773
node733
node803
63px3
node533
node843
node223
node23
node63
node73
node83
node93
node103
node113
node123
node43
node153
node133
node233
node523
node213
node33
node13
node03
node413
node423
node433
node463
node473
node483
node493
node823
node813
node1983
node1703
node1553
node1563
node1573
node1583
node1593
node1603
043
node1613
node1523
node1683
node1693
node1823
node1533
node1833
node1813
node1863
node1873
node1853
node1903
node1913
node1893
node1943
node1953
node1933
node1543
node1513
node913
node1173
node933
node953
node903
node1003
node1013
node1023
node1043
node1063
node1083
node1033
node1153
node1193
node1503
node1213
node1233
node1253
node1143
node1133
node1363
node1383
node1393
node1373
node1353
node1343
900-1900-3

Who hosts Viana.ru?

Viana.ru Hosting Provider Information

Hosted IP Address:85.119.149.99
Hosted Hostname:85.119.149.99
Service Provider:Academinform JSC
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:openresty

Is "Academinform JSC" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
Academinform JSC
0.0072%

HTTP Header Analysis for Viana.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Sat, 01 May 2021 20:31:32 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=20
Content-encoding: gzip

Viana.ru Domain Nameserver Information

HostIP AddressCountry
ns1.platformalp.ru 185.206.180.110
ns2.platformalp.ru 158.255.1.229


Need to find out who hosts Viana.ru?


Domain Registration (WhoIs) information for Viana.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: VIANA.RU
nserver: ns1.platformalp.ru.
nserver: ns2.platformalp.ru.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2000-05-17T12:00:46Z
paid-till: 2021-05-31T21:00:00Z
free-date: 2021-07-02
source: TCI

Last updated on 2021-05-01T20:26:30Z

Websites with Similar Names

Viana-drehi.com
Виана Стара Загора-производство на дамска конфекция
Viana-hotel.com
HugeDomains.com
Viana-langevin.com
viana-langevin.com is coming soon
Viana-studio.com
Viana-studio
Viana-tiendas-de-descuento.com
viana-tiendas-de-descuento.com
Viana.com.mx
viana.com.mx
Viana.info
viana.info - For Sale!
Viana.ru
Автотехцентр VIANA | Автосервис, разборка, магазин автозапчастей
Viana.ws
viana.ws - Coming soon
Viana7.com
Domain not yet activated

Recently Updated Websites

619classics.com (1 second ago.)Urbina-solutions.net (2 seconds ago.)Alsrori.net (3 seconds ago.)Westernembroidery.com (4 seconds ago.)Braidsplus.com (5 seconds ago.)Discoverthemiddleages.com (9 seconds ago.)Loudbyte.com (10 seconds ago.)Stbo.cn (11 seconds ago.)Izm.life (11 seconds ago.)Collegewoods.com (12 seconds ago.)211r.com (12 seconds ago.)Morrisonfive.com (13 seconds ago.)Weilanglighting.com (18 seconds ago.)Fairlong.com (20 seconds ago.)Aoa3798.vip (20 seconds ago.)Carlosseafood.com (20 seconds ago.)Toritunyushi.com (21 seconds ago.)Lukewarmstudio.com (23 seconds ago.)Choksipigments.com (24 seconds ago.)Runtheyear2016.com (24 seconds ago.)Sophies.app (26 seconds ago.)Renewableconsulting.net (26 seconds ago.)Apc.com (29 seconds ago.)Aoavip7990.com (30 seconds ago.)Ip-intercom.com (31 seconds ago.)Mikeadriano.org (31 seconds ago.)Prontocafestjoe.net (33 seconds ago.)Truesorb.com (33 seconds ago.)Promptinfoservices.com (33 seconds ago.)Huohuvip438.vip (34 seconds ago.)

Recently Searched Keywords

ds driver (1 second ago.)asakoboil (1 second ago.)esta gu (2 seconds ago.)airbag shop belgium (3 seconds ago.)a tecnológica reúne todo o canal de parceiros para apresentar estratégias e tecnologias que permitirão responder com eficiência à transformação digital das empresas (5 seconds ago.)getcreditscorefast.com (5 seconds ago.)предложение собственникам (5 seconds ago.)negli stati uniti (5 seconds ago.)date austday new (6 seconds ago.)2justify-selfstartalign-selfstartdata-modehover data-mesh-idcomp-k93izma5inlinecontent-gridcontainer (6 seconds ago.)bar mitzvah entertainers (6 seconds ago.)serkan ferat’dan “itiraf”a klip! (6 seconds ago.)0 1-1 4 (6 seconds ago.)josie prendergast (6 seconds ago.)gallery-item-titlecomp-k9rzsywb pro-galleryinline-styles gallery-item-container (8 seconds ago.)gallery-item-hoverdefaultforce-hoverbeforecomp-kg3p5r9p pro-galleryinline-styles (9 seconds ago.)złotoryja (9 seconds ago.)lacceptation (10 seconds ago.)㊭亚洲愉拍自拍另类天堂 (11 seconds ago.)cardssexysexy (11 seconds ago.)addresspasswordpassword (13 seconds ago.)ut maximus (15 seconds ago.)padding-bottom 18px important (15 seconds ago.)قیمت پسته بادامی ۹۸ (16 seconds ago.)mandiles (16 seconds ago.)hjælp (16 seconds ago.)сухие клеевые смеси murexin (16 seconds ago.)esined (17 seconds ago.)read morebreaking news: 1 dead after shooting at elk’s lodge in ames (17 seconds ago.)specialty products and insulation (17 seconds ago.)