South East Asia Holidays and Tours Specialists | Asia Holidays NZ

Safety: Low trust score
Year Founded: 2014
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

We're a small Auckland-based company offering outstanding South East Asia holidays & tours in Bali, Indonesia, Thailand, Vietnam, Myanmar, Laos & Cambodia.



Domain summary

Last updated
2021-09-26
Domain label
vietnam
Domain extension
nz
Domain registered:
2014-05-12
Domain updated:
2021-09-22
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Vietnam.nz registered?
A: Vietnam.nz was registered 7 years, 5 months, 1 week, 2 days, 59 minutes, 41 seconds ago on Monday, May 12, 2014.
Q: When was the WHOIS for Vietnam.nz last updated?
A: The WHOIS entry was last updated 4 weeks, 1 day, 59 minutes, 41 seconds ago on Wednesday, September 22, 2021.
Q: What are Vietnam.nz's nameservers?
A: DNS for Vietnam.nz is provided by the following nameservers:
  • ns1.whsl206.com
  • ns2.whsl206.com
  • ns3.whsl206.com
Q: Who is the registrar for the Vietnam.nz domain?
A: The domain has been registered at New Zealand Domain Name Registry Limited.
Q: What is the traffic rank for Vietnam.nz?
A: Vietnam.nz has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Vietnam.nz each day?
A: Vietnam.nz receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Vietnam.nz resolve to?
A: Vietnam.nz resolves to the IPv4 address 49.50.249.40.
Q: In what country are Vietnam.nz servers located in?
A: Vietnam.nz has servers located in the New Zealand.
Q: What webserver software does Vietnam.nz use?
A: Vietnam.nz is powered by LiteSpeed webserver.
Q: Who hosts Vietnam.nz?
A: Vietnam.nz is hosted by hd.net.nz in New Zealand.
Q: How much is Vietnam.nz worth?
A: Vietnam.nz has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Vietnam.nz Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Vietnam.nz Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Vietnam.nz

H1 Headings

0 :

H2 Headings

12 :
  1. Bali
  2. Bali
  3. Thailand
  4. Thailand
  5. Vietnam
  6. Vietnam
  7. Indonesia
  8. Indonesia
  9. Cambodia and Laos
  10. Cambodia and Laos
  11. Myanmar
  12. Myanmar (Burma)

H3 Headings

13 :
  1. Why Choose Us?
  2. We Love Asia
  3. Value for Money
  4. Fantastic Itineraries
  5. Earn Fly Buys
  6. Support Team
  7. Part of NZ's Largest Travel Group
  8. Search Tours
  9. SPECIALS
  10. EXPERIENCES
  11. OUR DESTINATIONS
  12. About Us
  13. Contact Details

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

13 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-58833142-4

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

55:

Links - Outbound (nofollow)

0:

Keyword Cloud for Vietnam.nz

textaligneaseinout otransition100msdisplay blockcmappsignupcontainercmapplightboxrotate270degtourshelvetica neuemarginlefthtmldivcsshelvetica neue helveticaboxsizingborderboxmargintop0opacity 15s1px solidcmappsuccessmsgcmappstatuscontainercmapphidden displaynonepadding10pxpositiondisplayblock fontsize12pxmargin5pxwebkittransform14pxfixedfontsize18px marginbottom10pxborder nonescale0we0 cmappsignupcontainercmappbardisplayinlineblockmarginbottom0 cmappsignupcontainercmappbarotransformdisplayfontsize3scmappsignupformcmappsuccessmsg padding10pxopacity 15s easeinoutrotate90degcmappprocessingmsg4pxlineardiv3s easeinoutwebkittransitionsouth east asia5pxnoneerr errboxsizingborderbox opacity120pxholidays1px20px 30px4width100 boxsizingborderbox0 0ultop 0displaynonecmappstatuscontainerposition fixedtransform 3s easeinoutopacityexperiencestransitioncmappsignupcontainerviewopacity1 margin16pxbackgroundcolor 100ms linearcmappstyledradio labelcmappsuccessmsg span displayblockcmappsignupcontainercmappembedded2px0pxtextareafontfamily helveticatravelpadding10px 20px50pxeaseinoutmargin5px 0scale0 0paddingboxsizingborderbox opacity1 margin16pxview pageboxshadow nonespanindonesiabordertransformlaostransform 3sasia holidayshelvetica arial sansserifspan displayblock fontsize12pxfontweight normal18pxfontsize 14pxmoztransformleft 0colorfontweight100ms linearvareastelsefontfamilylabel spannthchild1cmappstatuscontainercmapphiddencruisingbackgroundriverwidth 100cmappsuccessmsg spanbackgroundcolorboxshadowsolidvietnamposition relativeapplytranslatey102display inlineblockwhite1form9pxtextarea cmappsignupcontainermyanmarbaliabsoluteinlineblockthailandyourdisplay none20px 30px margintop0neuemargin16px 0fontfamily helvetica neueeaseinout transitionfontsize18pxcmappsignupcontainercmappbartextalignleft cmappsignupcontainerneue helveticaspanfirstchild fontsize18px marginbottom10pxourspanfirstchild fontsize18pxtop0 topeaseinout mstransition3cmappsignupcontainercmappbar cmappsuccessmsgselectarialcmappsignupcontainercmappslideouttabcmappsuccessmsg spanfirstchildnormalcmappcloseformbuttonmargin5px 0 06px15s easeinoutbackgroundcolor 100mshelvetica arialcmappsignupform ulwidth1000marginbottom0floatzindexcmappthankyoucheckwidth100 boxsizingborderbox opacity140pxarial sansserifasiaotransitionfindcmappsignupcontainercmappslideouttab cmappsuccessmsgrelative15seast asiatranslatex0cmappsuccessmsg spanfirstchild fontsize18pxcmappsignupcontainer cmappsignupform ulhtmldivmargin16px 0 0span displayblockcmappthankyoucheck width1000 0 cmappsignupcontainercmappbarfloat lefterrfunctionneue helvetica arialborder 1px solidposition absolute0 cmappsignupcontainerfffborder 1pxmstransitionspanfirstchildheightwidthcmappthankyoucheck width100 boxsizingborderboxcmappsignupcontainer cmappsignupformmargin 5pxdisplayblockpadding10px 20px 30pxcmappsignupcontainercmappslideouttab cmappslideouttabmargin 0mstransformcmappformheadernone cmappsignupcontainermargintopautospannthchild1cmappstyledradioleft16pxstyleshtmldivinnerhtmlfontsize12pxcmappsuccessmsg padding10px 20pxsouth2south east10pxopacity1 margin16px 030px margintop0cmappsignupcontainercmappembedded cmappsuccessmsgmorecmappsignupcontainercmapplightbox cmappsuccessmsgcmappsignupcontainercmappslideouttabcmappplacementleftushelveticatranslatex100labelblocktextalignleftsansserifopacity1none colortranslatex50htmldivinnerhtml htmldivcssminwidthyou30pxheight38pxcmappslideouttabmarginright 10pxvar htmldiveaseinout moztransitionmargin16pxrightcambodiamarginbottom10pxbeachespagemoztransitiontranslatey0

Longtail Keyword Density for Vietnam.nz

KeywordsOccurences
transform 3s ease-in-out9
background-color 100ms linear5
opacity 15s ease-in-out5
cmappsuccessmsg spanfirst-child font-size18px4
margin16px 0 04
south east asia3
cmappsuccessmsg span displayblock3
helvetica arial sans-serif3
neue helvetica arial3
helvetica neue helvetica3
font-family helvetica neue3
spanfirst-child font-size18px margin-bottom10px3
span displayblock font-size12px3
cmappsuccessmsg padding10px 20px3
20px 30px margin-top03
padding10px 20px 30px3
border 1px solid3
opacity1 margin16px 03
box-sizingborder-box opacity1 margin16px3
width100 box-sizingborder-box opacity13
cmappthankyoucheck width100 box-sizingborder-box3
0 0 cmappsignupcontainercmappbar3
margin5px 0 03
cmappsignupcontainer cmappsignupform ul3
0 014
100ms linear10
3s ease-in-out10
cmappsignupcontainer cmappsignupform9
transform 3s9
display inline-block6
view page6
display none6
opacity 15s5
border none5
15s ease-in-out5
background-color 100ms5
margin16px 04
htmldivinnerhtml htmldivcss4
font-size 14px4
spanfirst-child font-size18px4
cmappsuccessmsg spanfirst-child4
cmappsuccessmsg span4
margin 04
label spannth-child14
cmappstatuscontainercmapphidden displaynone4
float left4
var htmldiv4
box-shadow none4
position relative4
asia holidays4
display block4
width 1004
left 04
position fixed4
0 top3
cmappsignupcontainercmappslideouttab cmappslideouttab3
position absolute3
font-family helvetica3
helvetica neue3
neue helvetica3
helvetica arial3
arial sans-serif3
border 1px3
none cmappsignupcontainer3
cmappsignupcontainercmappslideouttab cmappsuccessmsg3
displayblock font-size12px3
cmappsignupcontainercmappembedded cmappsuccessmsg3
none color3
textarea cmappsignupcontainer3
cmappstyledradio label3
scale0 03
east asia3
south east3
cmappsignupform ul3
font-size18px margin-bottom10px3
30px margin-top03
span displayblock3
top 03
ease-in-out transition3
0 cmappsignupcontainercmappbar3
ease-in-out -o-transition3
margin 5px3
margin-bottom0 cmappsignupcontainercmappbar3
font-weight normal3
ease-in-out -ms-transition3
0 cmappsignupcontainer3
ease-in-out -moz-transition3
cmappsignupcontainercmappbar cmappsuccessmsg3
text-alignleft cmappsignupcontainer3
margin5px 03
right 10px3
cmappthankyoucheck width1003
width100 box-sizingborder-box3
box-sizingborder-box opacity13
opacity1 margin16px3
1px solid3
cmappsignupcontainercmapplightbox cmappsuccessmsg3
cmappsuccessmsg padding10px3
padding10px 20px3
20px 30px3
err err3
056
cmappsignupcontainer43
none25
cmappsignupcontainercmappbar21
transform21
display16
margin15
ease-in-out15
left13
cmappsuccessmsg13
-webkit-transform13
background-color12
top12
-ms-transform12
cmappsignupform12
var11
position11
cmappsignupcontainercmappslideouttab11
-o-transform10
10px10
-moz-transform10
3s10
auto10
100ms10
linear10
width10
opacity9
19
border9
padding9
cmappsignupcontainercmapplightbox9
label9
cmappsignupcontainercmappembedded8
font-size8
err8
color7
us7
height7
4px7
view7
5px7
asia6
we6
htmldivcss6
box-shadow6
cmappthankyoucheck6
right6
htmldivinnerhtml6
20px6
helvetica6
inline-block6
displayblock6
page6
span6
cmappstatuscontainer5
cmappstatuscontainercmapphidden5
0px5
normal5
your5
translatey05
translatex05
div5
travel5
cmappslideouttab5
translatey1025
rotate90deg5
textarea5
translatey-1025
font-size12px5
50px5
holidays5
translatex1005
translatex-1005
18px5
translatex-505
15s5
rotate270deg5
laos4
float4
margin16px4
displaynone4
margin-bottom04
indonesia4
font-family4
font-size18px4
spanfirst-child4
form4
font-weight4
-webkit-transition4
cambodia4
thailand4
24
relative4
spannth-child14
cmappstyledradio4
1px4
solid4
2px4
vietnam4
transition4
bali4
9px4
background4
styles4
fixed4
htmldiv4
6px4
block4
14px4
experiences4
myanmar4
-moz-transition4
-ms-transition4
white4
-o-transition4
you4
40px3
absolute3
ul3
height38px3
margin-left3
scale03
select3
16px3
displayinline-block3
sans-serif3
arial3
neue3
beaches3
margin-top3
cmappsignupcontainercmappslideouttabcmappplacementleft3
text-alignleft3
function3
find3
apply3
33
more3
our3
min-width3
fff3
text-align3
z-index3
east3
south3
else3
margin-bottom10px3
river3
tours3
cruising3
margin5px3
cmappformheader3
cmappprocessingmsg3
cmappcloseformbutton3
width1003
box-sizingborder-box3
opacity13
padding10px3
30px3
margin-top03
43

Who hosts Vietnam.nz?

Vietnam.nz Hosting Provider Information

Hosted IP Address:49.50.249.40
Hosted Hostname:sarah.whsl206.com
Service Provider:hd.net.nz
Hosted Country:New ZealandNZ
Location Latitude:-41
Location Longitude:174
Webserver Software:LiteSpeed

Is "hd.net.nz" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
hd.net.nz
0.0029%

HTTP Header Analysis for Vietnam.nz

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
Keep-Alive: timeout=5, max=100
content-type: text/html; charset=UTF-8
x-pingback: https://asiaholidays.co.nz/xmlrpc.php
link:; rel=shortlink
transfer-encoding: chunked
content-encoding: gzip
vary: Accept-Encoding
date: Sun, 26 Sep 2021 19:13:30 GMT
server: LiteSpeed
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"

Vietnam.nz Domain Nameserver Information

HostIP AddressCountry
ns1.whsl206.com 94.46.223.163
ns2.whsl206.com 49.50.249.42
ns3.whsl206.com 94.46.223.164


Need to find out who hosts Vietnam.nz?


Domain Registration (WhoIs) information for Vietnam.nz

 % Terms of Use
%
% By submitting a WHOIS query you are entering into an agreement with Domain
% Name Commission Ltd on the following terms and conditions, and subject to
% all relevant .nz Policies and procedures as found at https://dnc.org.nz/.
%
% It is prohibited to:
% - Send high volume WHOIS queries with the effect of downloading part of or
% all of the .nz Register or collecting register data or records;
% - Access the .nz Register in bulk through the WHOIS service (ie. where a
% user is able to access WHOIS data other than by sending individual queries
% to the database);
% - Use WHOIS data to allow, enable, or otherwise support mass unsolicited
% commercial advertising, or mass solicitations to registrants or to
% undertake market research via direct mail, electronic mail, SMS, telephone
% or any other medium;
% - Use WHOIS data in contravention of any applicable data and privacy laws,
% including the Unsolicited Electronic Messages Act 2007;
% - Store or compile WHOIS data to build up a secondary register of
% information;
% - Publish historical or non-current versions of WHOIS data; and
% - Publish any WHOIS data in bulk.
%
% Copyright Domain Name Commission Limited (a company wholly-owned by Internet
% New Zealand Incorporated) which may enforce its rights against any person or
% entity that undertakes any prohibited activity without its written
% permission.
%
% The WHOIS service is provided by NZRS Limited.
%
version: 8.7
query_datetime: 2021-09-27T08:13:37+13:00
domain_name: vietnam.nz
query_status: 200 Active
domain_dateregistered: 2014-12-05T09:42:02+13:00
domain_datelastmodified: 2021-09-22T07:06:51+12:00
domain_datecreated: 2014-12-05T09:42:02+13:00
domain_delegaterequested: yes
domain_signed: no
%
registrar_name: Metaname
registrar_address1: PO Box 32133
registrar_city: Christchurch
registrar_province: Canterbury
registrar_postalcode: 8147
registrar_country: NZ (NEW ZEALAND)
registrar_phone: +64 800 00 12 93
registrar_email: Login to show email
ns1.whsl206.com
ns_name_02: ns2.whsl206.com
ns_name_03: ns3.whsl206.com
ns_name_04: ns4.whsl206.com
%
% Additional information may be available at https://www.dnc.org.nz/whois/search?domain_name=vietnam.nz
%

Websites with Similar Names

Vietnaam88.com
Vietnaam|Up Eastside Vietnamese Food|Sandwich|Pho Restaurant| New York City
Vietnahlhockey.com
Vietnahl Hockey – VIETNAHL HOCKEY
Vietnailexpo.com
Site Unavailable
Vietnails.salon
vietnails.salon | Registrado en DonDominio
Vietnailsalon.com
Free Đăng Quảng Cáo Sang Tiệm Nails, Tìm Thợ Nails - VietNailSalon

Recently Updated Websites

Pssr.pro (3 seconds ago.)Myinfiniteservices.info (4 seconds ago.)Ermesamakina.com (4 seconds ago.)Webaver.com (5 seconds ago.)Madvertizers.com (5 seconds ago.)Thekepner.com (5 seconds ago.)Wysct.com (6 seconds ago.)4480t.com (8 seconds ago.)Intheproject.com (8 seconds ago.)Engineinstallations.com (8 seconds ago.)Cathisgarden.com (10 seconds ago.)Thirstyghostbrewing.com (11 seconds ago.)Tcroptin.com (12 seconds ago.)Kerrville.email (13 seconds ago.)Jippii-shopping.com (14 seconds ago.)Paulsbarondds.com (15 seconds ago.)Gotpickleballmagazine.com (15 seconds ago.)Svrider.de (15 seconds ago.)Yaolongpipe.com (16 seconds ago.)Pmc-logistics.com (16 seconds ago.)Careerjob-assistance.com (17 seconds ago.)Flhouston.org (19 seconds ago.)Churchofthearchangels.net (21 seconds ago.)Millontaco.com (22 seconds ago.)Sg.video (24 seconds ago.)Johnsontaylorlaw.com (24 seconds ago.)Planetdexterslab.com (24 seconds ago.)Alovelinksplus.com (24 seconds ago.)Historicalcoinprices.com (26 seconds ago.)Yogiind.com (26 seconds ago.)

Recently Searched Keywords

formattruetype (1 second ago.)arsenal fixtures (1 second ago.)000000boxshadow0 0 0 (2 seconds ago.)je direct (2 seconds ago.)kamusta meaning (3 seconds ago.)asendia hub rodgau (scl) (4 seconds ago.)강습 (5 seconds ago.)arquitectnicos (7 seconds ago.)new york state unemployment (8 seconds ago.)html editor (9 seconds ago.)permanentes (9 seconds ago.)40653 reviewsrated excellent by our customers (9 seconds ago.)esperienza emozionale (10 seconds ago.)unwritten rule (10 seconds ago.)bokep hentai (11 seconds ago.)brandable clothing (12 seconds ago.)big white (12 seconds ago.)sijoittajan opas (13 seconds ago.)latas de aluminio (14 seconds ago.)melanie (14 seconds ago.)goz 0067a - computergest. auswertung z. diagnose  (15 seconds ago.)jairo (16 seconds ago.)pittsburgh pop up pumpkin festival (17 seconds ago.)premios (17 seconds ago.)oven classic turkey and cheddar cheese duos (17 seconds ago.)thưởng thức đặc sản thịt lợn sapa – đậm đà bản sắc dân tộc (17 seconds ago.)con ging (18 seconds ago.)text-box-1612523885 (19 seconds ago.)cliente novo (19 seconds ago.)sociis (19 seconds ago.)