Vistek.ca Website Analysis Summary

Vistek.ca  |  Vistek is Canada's Camera store - shop for the top brands of dslr cameras, camera lenses, digital cameras, 4k video camcorders, and camera accessories
Low trust score  | 
Vistek is Canada's Digital Camera Store, Shop for DSLRs, Digital Cameras, 4k Video Cameras and more - Toronto, Calgary, Edmonton, Canada


Rank
181,920
Rating
F
Trust Score
Low Trust Score
Estimated worth
$69,000
Estimated daily income
$115
Estimated monthly income
$3,498
Backlinks
0

Vistek.ca has a Low Trust Score, and a Statvoo Rank of F.

Vistek.ca is hosted by Data Return in Texas, Irving, United States, 75039.
Vistek.ca has an IP Address of 209.251.177.155 and a hostname of 209.251.177.155.

The domain vistek.ca was registered 1 decade 9 years 3 months ago by , it was last modified 5 years 1 month 3 weeks ago and currently is set to expire 4 years 1 month 2 weeks ago.

It is the world's 181,920 most popular site among over 300 million websites.

Vistek.ca has a total of 0 backlinks.

Vistek.ca gets approximately 6,831 unique visitors a day and 45,955 pageviews per day.

Vistek.ca has an estimated worth of $69,000.
An average daily income of approximately $115, which is wroughly $3,498 per month.

Whois information for vistek.ca

Full Whois Lookup for Vistek.ca Whois Lookup

Domain name: vistek.ca
Domain status: registered
Creation date: 2000/09/27
Expiry date: 2017/12/01
Updated date: 2017/01/15
DNSSEC: Unsigned

Registrar:
Name: Rebel.ca Corp.
Number: 45

Registrant:
Name: Vistek Inc.

Administrative contact:
Name: Ron Silverstein
Postal address: 496 Queen ST E
Toronto ON M5A 4G8 Canada
Phone: +1 (416) 365 1777 3300
Fax: +1 (416) 365 7776
Email: Login to show email
contact:
Name: Ron Silverstein
Postal address: 496 Queen ST. E.
Toronto ON M5A 4G8 Canada
Phone: +1 (416) 365 1777 3300
Fax: +1 (416) 365 7776
Email: Login to show email
servers:
ns1.p20.dynect.net
ns2.p20.dynect.net
ns3.p20.dynect.net
ns4.p20.dynect.net

% WHOIS look-up made at 2017-08-16 10:11:40 (GMT)
%
% Use of CIRA's WHOIS service is governed by the Terms of Use in its Legal
% Notice, available at http://www.cira.ca/legal-notice/?lang=en
%
% (c) 2017 Canadian Internet Registration Authority, (http://www.cira.ca/)

Who hosts Vistek.ca?

Vistek.ca Web Server Information

Hosted IP Address:209.251.177.155
Hosted Hostname:209.251.177.155
Service Provider:Data Return
Hosted Country:United StatesUS
Location Latitude:32.88
Location Longitude:-96.94
Webserver Software:Not Applicable

HTTP Header Analysis for Vistek.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Wed, 08 Jul 2015 01:56:45 GMT
Content-Length: 25574

Need to find out who hosts Vistek.ca?

Vistek.ca Free SEO Report

Website Inpage Analysis for Vistek.ca

H1 Headings:0
H2 Headings:11
Brand New from Nikon
NEW!
EOS 1DX Mark III plus accessories!
NEW!
Introducing the new Panasonic HC-X1500, HC-X2000 and AG-CX10
NEW!
Welcome the new Wacom One creative pen display
NEW!
Benro Tripods & Gimbals on Sale
Camera Bags on Sale
LEDGO lighting on Sale
H3 Headings:9
Your Cart View
Popular Categories
Feature Brands
The Vistek Difference
Try before you buy promotions
Helping creatives like you for 40 years
As image-makers, we’ve all travelled the path of trial and error, hoping it leads to a point where vision, gear and performance work in perfect harmony.
Shop with Confidence at Vistek
Sales, Events and more every Week!
H4 Headings:13
The stunning D780 DSLR, a cool new Coolpix, some stellar new lenses – and more!
Canon’s amazing new pro-level DSLR is available with a bonus 512GB memory card and card reader, plus a rechargeable lithium-ion battery.
Powerful and feature-packed, they’re among the smallest and lightest 4K 60p camcorders on the market.
The cordless pen glides across the glass surface as if it were paper.
High quality. Innovative design. Exceptional value.
Expensive gear requires extra protection – cases designed to resist the knocks of travel and production, and can tough it out in any environment.
Quality LED lighting for professional video and photo applications
Sony Try & Buy Program
Fujifilm Try and Buy Promotion
Panasonic Try Before You Buy
local_shipping Free Shipping
verified_user Expert Advice
loyalty Incredible selection
H5 Headings:12
A Unique Selection
Great Rentals
Engaging Events
ProFusion Expo
Nice to meet you!
Store Info
Our Services
Shopping Info
Subscribe to Newsletter
Need Help? We are a call away 1.888.365.1777
Shop Safe
We Accept
H6 Headings:27
CAMERAS
LENSES
CAMERA ACCESSORIES
PERIPHERALS
VIDEO CAMERAS
LENSES
VIDEO ACCESSORIES
PRODUCTION & POST
PRO AUDIO
LIGHTING
LIGHT CONTROL
SUPPORT & BACKGROUNDS
LIGHTING ACCESSORIES
PRINTERS
PAPER & INK
VISUAL & COMPUTERS
DISPLAY & MEDIA
CAMERAS & LENSES
VIDEO
LIGHTING
TRIPODS & SUPPORT
AUDIO & DIGITAL
ABOUT RENTALS
PHOTO
VIDEO & AUDIO
LIGHTING
DISPLAY & PRINT
Total IFRAMEs:0
Total Images:91
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Vistek.ca

bodysaveidfalsebuy nownotmyclearanceproshowcasecameratrymemoryblank mustopen boxe trydisplaysdemoprintercustom1makeyouryour accountread moreread more buywishlistcustomervar googletagparamshelplightingcameras cameracatch eproductmediavistek accountenterpro photographybrand showcasemust enteremailplease make surecodetrueinkjetview raquoprintersgoogle analyticscreateimaginggasetaccountsonygoogleplease maketypegoogletagparams ecommprodidecommpagetypesureamp mediapro videoiffunctionecommtotalvaluetripodsphotographymdashcamcordersaccessoriesmust notecommprodidnowaccount signpleasecartleft blankviewcentrecatchdigitalvalidpaperreadmore buy noweventsdimensionmorepolicysupportvideomostgoogletagparamscardsbuynikonover0camera accessoriesphotocamerasmake surecustom dimensionmustsignopenproductscasesshoppingleftdslrvistekledmemory cardsdslr camerastry gasetsethavescomputersonlinecatch e tryamphomeblankyoumenuloginswitchbuttonphotofinishingsure that dimensionbranderaquoboxenter a validcontactleft blank mustcanonblank must enterremarketingmore buyvarbatteriesanalyticslensesvar googletagparams ecommprodidenewsblackinformationrentalscreate yournot be leftgoequipment

Longtail Keyword Density for Vistek.ca

KeywordsOccurences
more buy now20
read more buy20
not be left6
please make sure5
sure that dimension3
catch e try3
blank must enter3
left blank must3
enter a valid3
var googletagparams ecommprodid3
more buy20
buy now20
read more20
dslr cameras9
must not6
left blank6
make sure5
please make5
your account4
vistek account4
pro video4
var googletagparams4
memory cards4
camera accessories4
open box4
googletagparams ecommprodid3
google analytics3
try gaset3
catch e3
e try3
custom dimension3
account sign3
brand showcase3
pro photography3
amp media3
view raquo3
cameras camera3
blank must3
create your3
must enter3
more23
read20
pro20
buy20
now20
cameras19
amp18
var13
if12
save12
vistek12
false11
your11
accessories11
account11
video10
dslr9
must9
you8
digital8
home7
camcorders7
blank7
camera7
lenses6
sign6
06
computers6
not6
dimension6
function6
true6
printers6
left6
cart6
google5
product5
cards5
events5
id5
code5
please5
rentals5
make5
email5
sure5
equipment5
clearance5
try5
media5
15
lighting5
customer4
ecommprodid4
have4
googletagparams4
mdash4
information4
create4
ecommtotalvalue4
catch4
view4
ecommpagetype4
black4
canon4
body4
menuloginswitchbutton4
nikon4
custom4
e4
contact4
imaging4
photo4
over4
led4
brand4
memory4
paper4
go4
box4
sony4
set4
open4
batteries3
displays3
gaset3
remarketing3
analytics3
inkjet3
products3
wishlist3
help3
centre3
online3
photofinishing3
my3
photography3
tripods3
support3
demo3
s3
policy3
shopping3
enter3
valid3
enews3
raquo3
printer3
most3
cases3
showcase3
type3

What are the nameservers for vistek.ca?

Vistek.ca Domain Nameserver Information

HostIP AddressCountry
ns1.p20.dynect.net 208.78.70.20United States United States
ns2.p20.dynect.net 204.13.250.20United States United States
ns3.p20.dynect.net 208.78.71.20United States United States
ns4.p20.dynect.net 204.13.251.20United States United States

Vistek.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Vistek.ca is a scam?