Vistek.ca  |  Vistek is Canada's Digital Camera Store, Shop for DSLRs, Digital Cameras, 4k Video Cameras and more - Toronto, Calgary, Edmonton, Canada
Low trust score  | 
Vistek is Canada's Camera store - shop for the top brands of dslr cameras, camera lenses, digital cameras, 4k video camcorders, and camera accessories

Vistek.ca Website Information

Vistek.ca has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 69,219, a Majestic Rank of 146,355, a Domain Authority of 54% and is not listed in DMOZ.

Vistek.ca is hosted by Data Return in Texas, Irving, United States, 75039.
Vistek.ca has an IP Address of 209.251.177.155 and a hostname of 209.251.177.155.

The domain vistek.ca was registered 1 decade 8 years 10 months ago by , it was last modified 4 years 8 months 3 weeks ago and currently is set to expire 3 years 8 months 2 weeks ago.


Whois information for vistek.ca

Full Whois Lookup for Vistek.ca Whois Lookup

Domain name: vistek.ca
Domain status: registered
Creation date: 2000/09/27
Expiry date: 2017/12/01
Updated date: 2017/01/15
DNSSEC: Unsigned

Registrar:
Name: Rebel.ca Corp.
Number: 45

Registrant:
Name: Vistek Inc.

Administrative contact:
Name: Ron Silverstein
Postal address: 496 Queen ST E
Toronto ON M5A 4G8 Canada
Phone: +1 (416) 365 1777 3300
Fax: +1 (416) 365 7776
Email: Login to show email
contact:
Name: Ron Silverstein
Postal address: 496 Queen ST. E.
Toronto ON M5A 4G8 Canada
Phone: +1 (416) 365 1777 3300
Fax: +1 (416) 365 7776
Email: Login to show email
servers:
ns1.p20.dynect.net
ns2.p20.dynect.net
ns3.p20.dynect.net
ns4.p20.dynect.net

% WHOIS look-up made at 2017-08-16 10:11:40 (GMT)
%
% Use of CIRA's WHOIS service is governed by the Terms of Use in its Legal
% Notice, available at http://www.cira.ca/legal-notice/?lang=en
%
% (c) 2017 Canadian Internet Registration Authority, (http://www.cira.ca/)

Who hosts Vistek.ca?

Vistek.ca Web Server Information

Hosted IP Address:209.251.177.155
Hosted Hostname:209.251.177.155
Service Provider:Data Return
Hosted Country:United StatesUS
Location Latitude:32.88
Location Longitude:-96.94
Webserver Software:Not Applicable

HTTP Header Analysis for Vistek.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Wed, 08 Jul 2015 01:56:45 GMT
Content-Length: 25574


Need to find out who hosts Vistek.ca?

Vistek.ca Free SEO Report

Website Inpage Analysis for Vistek.ca

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Vistek.ca

nikonbodyremarketingamp mediae tryblanksupportcodeecommpagetypecarttruecreate yourshowcasenotphotomemorysureraquobuycustomphotographypro photographyvar googletagparams ecommprodidvar googletagparamsvarledpro videoproductsenewsidbrand showcaseinkjettripodsclearanceleft blankpleasecameraeventsblank must enterdemogoogletagparamswishlistdisplayscatchifopen boxreadread more buyinformationampmore buy nowblackshoppingproducthomeequipmentprinterbatteriescasesemailsetcatch e tryplease makememory cardsgocamerasemoredimensionprosonyblank mustecommtotalvaluenot be leftpolicysure that dimensionvideoprintersview1please make surecustomerfalsecreatesigngasetenter a validcanonboxgoogletagparams ecommprodidyouphotofinishingtrycustom dimensionentercontactmustcameras cameracatch egoogle analyticsfunctionscamera accessoriesvistek accountmakeleft blank mustview raquodigitalmenuloginswitchbutton0make surecamcorderstry gasetmdashrentalshelpmostbrandmore buyvistekcardsgooglemydslr camerasonlinemust notanalyticsbuy nownowoveraccessoriesecommprodidyour accountlightinglenseshavecomputerstypevalidread moremust entermediasavepaperopenimagingaccount signleftdslrcentreaccountyour

Longtail Keyword Density for Vistek.ca

KeywordsOccurences
more buy now20
read more buy20
not be left6
please make sure5
sure that dimension3
catch e try3
blank must enter3
left blank must3
enter a valid3
var googletagparams ecommprodid3
more buy20
buy now20
read more20
dslr cameras9
must not6
left blank6
make sure5
please make5
your account4
vistek account4
pro video4
var googletagparams4
memory cards4
camera accessories4
open box4
googletagparams ecommprodid3
google analytics3
try gaset3
catch e3
e try3
custom dimension3
account sign3
brand showcase3
pro photography3
amp media3
view raquo3
cameras camera3
blank must3
create your3
must enter3
more23
read20
pro20
buy20
now20
cameras19
amp18
var13
if12
save12
vistek12
false11
your11
accessories11
account11
video10
dslr9
must9
you8
digital8
home7
camcorders7
blank7
camera7
lenses6
sign6
06
computers6
not6
dimension6
function6
true6
printers6
left6
cart6
google5
product5
cards5
events5
id5
code5
please5
rentals5
make5
email5
sure5
equipment5
clearance5
try5
media5
15
lighting5
customer4
ecommprodid4
have4
googletagparams4
mdash4
information4
create4
ecommtotalvalue4
catch4
view4
ecommpagetype4
black4
canon4
body4
menuloginswitchbutton4
nikon4
custom4
e4
contact4
imaging4
photo4
over4
led4
brand4
memory4
paper4
go4
box4
sony4
set4
open4
batteries3
displays3
gaset3
remarketing3
analytics3
inkjet3
products3
wishlist3
help3
centre3
online3
photofinishing3
my3
photography3
tripods3
support3
demo3
s3
policy3
shopping3
enter3
valid3
enews3
raquo3
printer3
most3
cases3
showcase3
type3

What are the nameservers for vistek.ca?

Vistek.ca Domain Nameserver Information

HostIP AddressCountry
ns1.p20.dynect.net 208.78.70.20United States United States
ns2.p20.dynect.net 204.13.250.20United States United States
ns3.p20.dynect.net 208.78.71.20United States United States
ns4.p20.dynect.net 204.13.251.20United States United States

Vistek.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Vistek.ca is a scam?