Tekstenfee

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-12-23
Category: This site has not been categorized yet

Tekstenfee visuele en tekstuele content creatie voor iedereen die graag zijn talent wil delen.


Domain summary

Domain label
visueel
Domain extension
online
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is visueel.online ranked relative to other sites:

Percentage of visits to visueel.online from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Visueel.online registered?
A: Visueel.online was registered 2 months, 2 weeks, 13 hours, 59 minutes, 56 seconds ago on Wednesday, December 23, 2020.
Q: When was the WHOIS for Visueel.online last updated?
A: The WHOIS entry was last updated 2 months, 2 weeks, 13 hours, 59 minutes, 56 seconds ago on Wednesday, December 23, 2020.
Q: Who is the registrar for the Visueel.online domain?
A: The domain has been registered at .
Q: What is the traffic rank for Visueel.online?
A: Visueel.online has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Visueel.online each day?
A: Visueel.online receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Visueel.online resolve to?
A: Visueel.online resolves to the IPv4 address 91.184.0.62.
Q: In what country are Visueel.online servers located in?
A: Visueel.online has servers located in the Netherlands.
Q: What webserver software does Visueel.online use?
A: Visueel.online is powered by Apache webserver.
Q: Who hosts Visueel.online?
A: Visueel.online is hosted by Hostnet B.V. in Netherlands.
Q: How much is Visueel.online worth?
A: Visueel.online has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Visueel.online Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Visueel.online Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Visueel.online

H1 Headings

0 :

H2 Headings

38 :
  1. een creatieve studio​voor visuele zichtbaarheid
  2. uniek design
  3. grafisch ontwerp
  4. op natuurlijke wijze
  5. ​visueel & tekstueel​helder​communiceren maakt je​
  6. Tekstenfee geeft vorm aan​woord & beeld​met focus op jouw passies
  7. omdat het best lastig kan zijn je talent over te brengen
  8. Waarvan ik energie van krijg?​Vormgeven in tekst & beeld​is wat ik met liefde doe.
  9. ​Ik ondersteun mensen bij​het krachtig & authentiek zichtbaar worden​
  10. Samen creëren we iets​ unieks​​
  11. ​Wie is tekstenfee?
  12. ​Ik zet al mijn talenten in om ieder die met hart & ziel wenst te werken, natuurlijk zichtbaar te maken.
  13. ​Wat zeggen ​jouw​voorgangers?
  14. tover mee!​
  15. ik kijk ernaar uit met je samen te werken!​​
  16. Step 1​focus
  17. Step 2 ​concept
  18. Step 3​creatie
  19. tarieven
  20. focusgesprek
  21.  € 250 ex btw.
  22. logoontwerp
  23. ​ € 350 ex btw.
  24. tekstschrijven
  25. uurtarief 50,- ex btw.
  26. grafisch ontwerp
  27. in overleg
  28. starter? begin!
  29.  € 1.200,- ex btw.​
  30. fotografie
  31. in overleg
  32. HOME
  33. FOCUS
  34. CONCEPT
  35. CREATIE
  36. PORTFOLIO
  37. TIPS & TRICKS
  38. webdesign tekstenfee.nl ©2020

H3 Headings

19 :
  1. focus . concept . creatie
  2. hier vind je
  3. visuele content
  4. tekstuele content
  5. Gonneke Berendsen
  6. Gonneke Berendsen
  7. Myrna van Kemenade
  8. Myrna van Kemenade
  9. Laureano Boerman
  10. Gre de Joode
  11. Gre de Joode
  12. Hermine Schoneveld
  13. Hermine Schoneveld
  14. Bianca Rozendaal
  15. Hanna.
  16. Hanna.
  17. Melvin Goudbeek
  18. Hermine Schoneveld
  19. Silvia Saunders

H4 Headings

22 :
  1. eigenaar / Coachpraktijk Gonneke Berendsen
  2. Eigenaar / Praktijk voor  Coaching en Bewustwording
  3. Eigenaar / Yogadreams
  4. Eigenaar / Yogadreams en myrnavankemenade.nl
  5. Eigenaar / Rocket Stove Store
  6. Eigenaar / Rocket Stove Store
  7. Eigenaar / BOO personeelservice
  8. Eigenaar / BOO personeelservice
  9. Eigenaar / Womanwise
  10. Eigenaar / Womanwise
  11. /
  12. Eigenaar / Tout Toet 
  13. /
  14. Eigenaar / Hanna. - Tolk van de Ziel
  15. /
  16. Eigenaar / Hanna. - Tolk van de Ziel
  17. /
  18. Eigenaar / De Haptonoom
  19. /
  20. Eigenaar / Womanwise
  21. /
  22. Eigenaar / Sacred Suara

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

34 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-97218846-1

Links - Internal

22:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Visueel.online

thatupdate needifthisstartscroll clearintervalthisstartscroll thisstartscrolltransparentundefined documentdocumentelementappreadyportfolio tipsactualresizehandler executionwindow resize functioncall the initializeborderbox msboxsizing borderboxbootestimonialauthor displaydont wantthisconstructorsuperinitializeapplythis bindthis 100var display valuethatsettingsget smdocumentdocumentelementappreadyotransform scale11elementprototypesettingspageelementidwebkittransform scale11 otransform20px top 20pxborderbottomrightradius 40pxdatborderbox backgroundcolorbackgroundsize 100verticalalignundefined loadscripturltosomescriptjs functionvar elementheights8boxsizingelement elementdefinitionextend initializezoom 1paddingright 30pxget var maxheightnone userselect noneirhreturn coloredbox ifbackboneclearintervalthisstartscroll thisstartscrolltypeof documentdocumentelementappready undefinedflexnextelementprototypesettings newtransform rotate180degimportant element08b8520687984c6fa1cfea8658e83ecawplatformelementsplatformelementiddeferredobjectpromise ifintersectionwloadedplatformdependencies dependencieslengtharrowsizesmall flexdirectionnav6pxhoverhannaplatform elements requirefunczichtbaarelementdefinitionmobilesettingget false mobilesettingelementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplaceelements848857247979793891101assets newwplatformelementsplatformelementiddeferredobjectresolvenone khtmluserselecthidebox mozboxsizing borderboxbootestimonialavatarboohiddenbody body ifelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialsliderstyle6talentvaluesettimeoutfunctiondisplay that hideboxvisible functionwloadedplatformdependenciespushnextscriptdetermine whichslides lirotate180deg webkittransformscale11 webkittransformreturn thisouterheight getposition absolutespecific to platformvar sgaqtop norepeat element08b8520687984c6fa1cfea8658e83ecasettimeoutfunction ifthisstartscrolldisplay thatsettingsgetpadding 20pxfunction ignore resizehttpscdnjscloudflarecomajaxlibswow112wowminjsmaxheight mathmaxapplynullelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialcontentthiswaddonsanims waddonsanims function3 4paddingrightbootestimonialauthorboohidden displayhidebox csselfindlieqnextslidefindbooimageuntiltrans0 marginundefined typeofinitnull var platformelementid11function w backbonewindowrequire30px webkitbordertopleftradius 40pxconsolelogstop thisstartscrollundefined wplatformelementslong0 6px 6pxsomeobject undefined loadscripturltosomescriptjsfirst remove bodyaddclassanimationsincludedelremoveclassresizedbyheight elfindflexviewportanimate heightvar platformelementid 874959678356211109101stopdependencieslength dependencieslengthhead linkrelstylesheetfirstbefore waddonsanimationssheetnotopacity 1 backgroundbackground transwat ikheight 20pxprijs48pxfunction wnone element44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialslidervar elementdefinition platformelementextendbackbone utilplatformelementsplatformelementrotate180deg webkittransform rotate180degtrans background trans3px solidnone userselectnewbodyhasclassanimationsincludedhidebox platformelementextend updatebodyhasclassanimadded loadscriptvar coloredbox platformelementextendjquery backbonebootestimonialcontrols position absolutewe dont10px solid15pxplatform elementsutilplatformelementsplatformelementsettings functionmozbordertoprightradiusf8a9a9 important element44d82a7b0c6c40a995fcb4faa9d2d606element08b8520687984c6fa1cfea8658e83ecahermine schoneveld eigenaarutilplatformelementsplatformelement utilplatformelementsplatformelementsettings functionuse if widthcenter center borderborderbox function1px solid12pxwindowineditorbootestimonialavatarafter borderbottom 1pxboofullwidthsliderfullheight1getif typeof wplatformelementsplatformelementid40px mozbordertopleftradius 40pxnew deferred wplatformelementsplatformelementiddeferredpromiseaafterfast elfindlieqnextslidefindbooimageif resizetimeout nulldocumentdocumentelementattacheventonpropertychangeresizetimeout null thatactualresizehandlerbordertopleftradius 40px webkitbordertoprightradiusvisiblebottomwomanwise0 topwhichnew deferredasync true40px borderbottomleftradius 40pxboxsizing borderbox function1 backgroundthatsettingsgetsm elsethisstartscroll setintervalfunctionwaddonsanimations platformelementextendleft 0maxwidth nonesomeobject5schoneveldeaseinoutahoveraftersetupelement793747333772177856dependencieslength reducedependencieshave been replacedli a widthwaddonsanimationssheetnot first removemoztransform scale11position absolute bottom66mswindow resizesthisautoslide1000 mathroundthisautoslide21000var currenthidebox hideboxcontent mozboxsizinglinkrelstylesheetfirstbefore waddonsanimationssheetnot firstwplatformelementsplatformelementiddeferredpromise wplatformelementsplatformelementiddeferredobjectpromiseundefined loadscripturltosomescriptjsthisbootestimonialslidecontentanimate heightelement44d82a7b0c6c40a995fcb4faa9d2d606 boostarratingfunction urlelement08b8520687984c6fa1cfea8658e83eca arrowstyle5watrelativedocumentdocumentelementappready 0 ifelement44d82a7b0c6c40a995fcb4faa9d2d606background1pxweconcept creatie portfoliopossible typeonlyh2wloadedplatformdependenciespushnextscript return promisethenfunctionberendsen5px 0webkitborderbottomrightradius 40pxflexviewportuntil placeholders have12px backgroundtop 48pxplatformelement function varcallback ajaxthisplaceholderinterval setintervalfunctionscreen and maxwidth992 display thatsettingsget9601675 elementprototypesiteidwaddonsanimationsinitialize function weleft 20pxfunction var mobilesettingmozborderbottomrightradius 40px0 0 10pxbootestimonialcontrols li clickscrollthatsettingsget xs elsefunction windowelementdefinition null varwebkittransition60pxwindowheight 14pxvisibility hiddensolid transwplatformelementsplatformelementid wplatformelementsplatformelementiddeferredobject newampunderscore jquery backbonewglobalwereldthissettingsgetmobiletrue var bodymozbordertopleftradiusthiswwsolid trans heightmetelement08b8520687984c6fa1cfea8658e83eca arrowstyle3 flexdirectionnavbootestimonialsliderstyle40 right 0clear bothhiddenreturn promisethenfunction4li clickscrollflexdirectionnav a widthwloadedplatformdependenciespushnextscript returnnone element44d82a7b0c6c40a995fcb4faa9d2d606we still wantconcepttouchendasyncleft30pxwloadedplatformdependencies undefined wloadedplatformdependenciesarrowstyle5 flexdirectionnavsetintervalfunction soontwerp0 vardisplay to usekhtmluserselect nonefff borderradius 100pxfunctionpromise nextscriptnew platformelementsettingsxsnonesmnonemdblocklgblockthisstartscrollmobilesettingget 0heb jeifintersectionwloadedplatformdependencies dependencieslength dependencieslengthelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialsliderstyle1100pxheightmobilesetting initpaddingright 30px webkitbordertopleftradius50 auto startdatatype scriptparagraphget screencontent display blockeventpropertyname appreadyborderbottomleftradiuselementdefinition function var40px mozbordertopleftradiuswidth determineboofullwidthslider marginif thisplatformelementchildplaceholderlength 0var wwarrowsizelargewebkitboxsizingwidth 100 importantbodyaddclassanimaddedcenter border 3pxrequiresolid fffvar dependenciesmargintop 20pxvar element elementdefinitionextendborderbottomleftradius 40pxcheck for placeholdersstart timemd else displayelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialsliderstyle5h4flexcontrolnavbootestimonialsliderstyle6thisbootestimonialsliderhoverfunction ifthisstartscroll clearintervalthisstartscrollborderradius 6px mozborderradiusifthisstartscroll clearintervalthisstartscrollvar current thisbulletfilteractivedataslidevar hidebox resizetimeoutdisplay none importantflexcontrolpaging lihideboxwidth width874959678356211109101 if typeofmedia only screensolid0 ifmdw backbone platformelement40px mozbordertoprightradius 40px0 clearintervalthisplaceholderinterval thisconstructorsuperinitializeapplythiseigenaarupdate valuemaxheightplatformelementextend var elementdisplay inlineblock0bootestimonialsliderthisautoslide1000 ifthisstoponhoverthatsettingsget sm elsewidth determine whichdisplay block995909419681669705 elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplaceelements971000768590423757101assetsimganimatemstransform rotate180degahovermarketplaceeditmysitecomuploadsbmarketplaceelements848857247979793891101assetsurlmarketplaceeditmysitecomuploadsbmarketplaceelements294973650257440885116assetsarrowstyle3prevpng norepeat centerwebkitborderbottomrightradiusqueue if resizetimeoutdocumentdocumentelementappready 0ifintersectionwloadedplatformdependencies dependencieslengthauto start timecubicbezier0770000001751000wplatformelements undefinedbordertopleftradiusifthisstoponhover hoverreturn coloredboximportant height autostep10px webkitborderradius 10pxwplatformelementsplatformelementiddeferredobject new deferredposition relative textalignelementae54737e18d44254b45829fe023b3effif typeof wloadedplatformdependencies15fpsdependencieslength 0 wplatformelementsplatformelementiddeferredobjectresolvetrans borderradiuspromisethenfunction wplatformelementsplatformelementiddeferredobjectresolve ifparagraph element44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialauthorurl callbackdatatype script successhowever we dont30px webkitbordertopleftradius40px mozborderbottomrightradius 40pxnone importantbordercolorvar elementinstallresizehandler function25pxcontentboxelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialauthor h3if width 1200consolelogstop thisstartscroll functionstillactualresizehandler functionpromisethenfunction wplatformelementsplatformelementiddeferredobjectresolvesetupelement761547243427691384display installresizehandler functionutilplatformelementsplatformelementdeferred wplatformelementsplatformelementiddeferredpromise wplatformelementsplatformelementiddeferredobjectpromisesm else ifh4 paragraphthisouterheightbodyhasclassanimationsincluded head848857247979793891101remove bodyaddclassanimationsincluded jqueryjquery backbone utilplatformelementsplatformelementscript successpaddingtop 20px paddingbottomflexdirectionnav flexprev backgroundjouelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialslider bootestimonialcontrolsplatformelementextend updatemozborderbottomleftradius 40px borderbottomleftradiushowever weimg position relativeposition relative important971000768590423757101 ifcreatie portfolio tipsw backbonemozborderbottomrightradiusdocumentcreateeventscreen widthzoomdisplay block element44d82a7b0c6c40a995fcb4faa9d2d606width 768typeof elementdefinition nulllg updateupdate functionuntil placeholdersdisplay thatsettingsget smtypeof wloadedplatformdependencieswindow resizeuse ifmobile mobilesetting initundefined documentdocumentelementappready 0dependencieshomedocumentcreateevent documentaddeventlistenerwebkittransformdisplay thatsettingsget lgdisplay block positionreturn waddonsanimations ifsamenwerking1px solid transpadding2 3borderbox boxsizingtecenter center element08b8520687984c6fa1cfea8658e83ecaclickscrollvar dependencies nullmobilesettingget thissettingsgetmobiletrueif bodyhasclassanimaddedwidth getborderbottom 1pxthatactualresizehandlerbootestimonialsliderstyle3wow mobileahover colorresize eventsif mobilesettingget 0coloredboxcontent clear bothbootestimonialfloat left widthelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialauthoriftypeofabsolute bottombordertopcurrentvisibility visible functionifthisequalheight varborderbottomwfalse else mobilesettingplatformelementsettingswaddonsanims functionf8a9a9falseh3 paragraphbootestimonialavataraftermozboxsizingschoneveld eigenaar womanwiserelative element08b8520687984c6fa1cfea8658e83ecabootestimonialcontent textalignifthisstoponhoverheight autoconcept creatiebootestimonialmapfunction returnnextscript wloadedplatformdependenciespushnextscriptthisplaceholderintervallg update valuereslidingwplatformelementsplatformelementiddeferredobjectresolve if dependencieslength848857247979793891101 if typeofwaddonsanimationssheetnottrans backgroundmozbordertopleftradius 40px bordertopleftradiusall 800ms cubicbezier0770000001751000requirefunc wglobalhome focus conceptfunction url callback100 heightfunction we stillleft widthwowbooslidecontent h2 element08b8520687984c6fa1cfea8658e83ecaresizesif documentdocumentelementappreadyelfindflexviewportanimate height ihplatformelementsettings varouserselectresizes thatinstallresizehandler returnplatformelementidthatinstallresizehandler return hidebox66 66msdocumentdocumentelementappready undefined documentdocumentelementappready40px mozborderbottomleftradius 40pxposition relative borderotransition allmarginbottomelfindflexactiveslide booimagexs elserelative border 0pxboofullwidthslidershowloading1current thisbulletfilteractivedataslidemozborderradius 100pxtipsdisplay thatupdatemathmaxapplynull elementheights thisbootestimonialslidecontentanimaterequired for element6px element44d82a7b0c6c40a995fcb4faa9d2d606heelthatsettingsget lg update0 0height 12px background9601675 elementprototypesiteid 995909419681669705float leftresizetimeout settimeout functionkanvalue of cssplatformelement platformelementsettingsborderbox mozboxsizing borderbox20pxplatformelementid 971000768590423757101 if40px mozborderbottomleftradiusfunction newbootestimonialauthor h3 paragraphbodyaddclassanimationsincludedincl 1resize function ignore100 mozboxsizing borderboxelement08b8520687984c6fa1cfea8658e83eca arrowsizemedium flexdirectionnavvoor jevoorarrowstyle3 flexdirectionnav0 margin 020px topclearintervalthisstartscroll consolelogstop thisstartscroll10px webkitborderradiuswebkitborderbottomleftradius 40pxelementprototypesiteid 995909419681669705 elementprototypeassetspathbackgroundsize 100 autobeensetupelement367381787745935168wplatformelementsplatformelementiddeferredpromise10px 10px 0elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplaceelements971000768590423757101assets new0 wplatformelementsplatformelementiddeferredobjectresolve wplatformelementsplatformelementiddeferredpromisedonefunctionfunction new wowelementprototypesiteidget screen width0 position absoluterateclearintervalthisstartscrollelementdefinition undefined typeofheight 0fff borderradiusmobilesetting var mobilesettinggeturl callback ajaxmarketplaceeditmysitecomuploadsbmarketplaceelements874959678356211109101assets newimportant heightbindthiselementprototypesiteid 995909419681669705coloredbox if typeof0 6pxwindowplatformelementrequire windowrequirebootestimonialsliderstyle7typeofmobile mobilesettinghave beenplatformelementid 971000768590423757101waddonsanimationblock100px webkitborderradius 100pxelementheights thisbootestimonialslidecontentanimatewidth window6px mozborderradiusfunction var hideboxmathmaxapplynullietsall 800msall 1smozborderbottomleftradiusvar requirefuncvarcss displayif bodyhasclassanimationsincluded head995909419681669705 elementprototypeassetspath100px element08b8520687984c6fa1cfea8658e83ecanbsphttpscdnjscloudflarecomajaxlibswow112wowminjs datatypeelement08b8520687984c6fa1cfea8658e83eca arrowsizesmallexecutefocusdisplay displayreturn getscriptnextscriptboostarrating70px10px element08b8520687984c6fa1cfea8658e83ecafirst removeall 3selremoveclassresizedbyheight elfindflexviewportanimateabsolute leftclearnorepeatelementsbodyaddclassanimadded ifcontent position absolutezindexqueue ifthatupdate initialize functionscale11 mstransformsthisplatformelementchildplaceholderlength 0 clearintervalthisplaceholderintervalloadscript800msthisbootestimonialslidecontentanimate height height25element44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialsliderstyle6 bootestimonialauthorzindex 1absolute widthbordertoprightradius 40px webkitborderbottomleftradiuseaseborderbox msboxsizingelementprototypeuseridconsolelogstopvalue of display26px height 20pxtrue function ifthisbulletfilteractivedataslidewebkitbordertoprightradiustypeof wplatformelements undefinedresliding settimeoutfunction ifthisstartscrollheight ih fastabsolute width 100trans heightloadscripturltosomescriptjs functionimganimate heightdefinedrelative important zindexih eladdclassresizedbyheight elfindflexviewportanimateimportant element08b8520687984c6fa1cfea8658e83eca booimageonly screengonnekereducedependencieselements displayborderbottom 1px solidop0 important element44d82a7b0c6c40a995fcb4faa9d2d606none ouserselect03shidebox resizetimeoutauto important bottomsetintervalfunction thisnextouserselect nonequeuemarjoleinrockettrans borderradius 6pxinitialize functionch100webkitborderradius 6pxsettimeout function resizetimeoutwaddonsanimationblock visibility hiddenclearintervalthisstartscroll consolelogstopvar nextslideelement08b8520687984c6fa1cfea8658e83eca boofullwidthsliderresizedbyheight slidespaddingleftdisplay thatupdate needwow mobile mobilesettingplaceholders if0px solidactualresizehandler function thatupdate4 59999pxleft 0 rightclear both floatthatinstallresizehandler returnelement08b8520687984c6fa1cfea8658e83eca textoverlay1 booslidecontentdocumentaddeventlistenerappreadyfastactualresizehandlernew wow mobileplatformelementsettings var dependenciesheight maxheight25100 importanttop norepeatwaddonsanimationblock visibility visiblebackgroundcolorch100 fast elsepaddingbottom 20px paddingleftif documentdocumentelementappready windowineditorih eladdclassresizedbyheightbooimagesetupelement730388386562724333platformsetupelement357991463328856721verticalalign middleurlmarketplaceeditmysitecomuploadsbmarketplaceelements294973650257440885116assetsarrowstyle3prevpngstop thisbootestimonialsliderhoverfunctionnull hidebox platformelementextendelementdefinition nullreturn thisouterheightsetupelement480460018851399267if typeof elementdefinitionwebkitborderbottomleftradius 40px mozborderbottomleftradiuseladdclassresizedbyheight1200 displaypaddingtopdisplay installresizehandlerupdate the elementsclearintervalthisplaceholderinterval thisconstructorsuperinitializeapplythis bindthiselements requirefuncvisibilityplatformelementsettingsxsnonesmnonemdblocklgblock elementprototypesettingspageelementidhavebackground fffwant to callfunction thiswaddonsanims waddonsanimsthisclickedminheight 100vhf8a9a9 importantelement08b8520687984c6fa1cfea8658e83eca boofullwidthsliderresizedbyheightwloadedplatformdependencies10px 0 0waddonsanimations ifif documentcreateevent documentaddeventlistenerelementprototypeuserid 9601675documentdocumentelementattacheventonpropertychange functionevent ifborderfunctionevent1440px webkitborderbottomleftradius 40pxdisplay display installresizehandlerfontsizeboxsizing borderbox backgroundcoloreladdclassresizedbyheight elfindflexviewportanimatesettimeoutbootestimonialcontrols liheight height25requirefunc windowplatformelementrequire windowrequirebackground trans borderradius40px webkitbordertoprightradiuswidth width windowelement elementdefinitionextendleft 0 topmozbordertoprightradius 40pxcenter bordernew elementhidebox css displayslidewebkituserselect40px mozborderbottomrightradiusglobalhome focusdocumentdocumentelementappready windowineditor windowineditornone khtmluserselect none0 position relativeextextoverlay1 booslidecontent h2boofullwidthsliderresizedbyheight slides booimagethatsettingsget md elsemozborderradius 6pxcenter centerelement08b8520687984c6fa1cfea8658e83eca flexcontrolnavimportantvar elementdefinitionfunction resizetimeout nullfocus conceptfunction defined100px mozborderradius 100pxmargin 02 3 4elementprototypeassetspath14pxalscriptmstransition allwidth 0if dependencieslengthtextoverlay1 booslidecontentposition relative overflowmarketplaceeditmysitecomuploadsbmarketplaceelements971000768590423757101assetsusecursorhideboxcontentborderbottomrightradiussomobilesetting10px mozborderradiusflexprev background fffbootestimonialavatarwidth 1200 displayontwerpenmargin 0 autonextscript0 importantwebkitborderradius 100px element44d82a7b0c6c40a995fcb4faa9d2d606mozbordertopleftradius 40pxhold on 50elementprototypeuserid 9601675 elementprototypesiteid15fps actualresizehandler functionnull hideboxwplatformelementsplatformelementiddeferredobjectresolve wplatformelementsplatformelementiddeferredpromisedonefunction17pxminheight 200pxthisbootestimonialsliderhoverfunction ifthisstartscrollwindow resizes thatinstallresizehandler20px paddingbottomplatformelement functionif bodyhasclassanimationsincludedelementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplaceelements848857247979793891101assets100px element44d82a7b0c6c40a995fcb4faa9d2d606element08b8520687984c6fa1cfea8658e83eca flexviewportget varvar mobilesettinggetelfindlieqnextslidefindbooimage imganimate534040 important element44d82a7b0c6c40a995fcb4faa9d2d606platformelementextend initializeelement08b8520687984c6fa1cfea8658e83eca arrowsizelarge flexdirectionnavflexdirectionnav flexprevpaddingleft 30pxmaxheight25 else varscript success callbackvalue to useappidboxsizing borderboxheight 100hidebox mozboxsizingspecificbootestimonialavatar imgurlmarketplaceeditmysitecomuploadsbmarketplaceelements294973650257440885116assetsarrowstyle3prevpng norepeatelse display thatsettingsgetdocumentaddeventlistenerelementdefinition undefinedahover element08b8520687984c6fa1cfea8658e83ecafast elfindlieqnextslideanimatetextalign centerdocumentdocumentelementappready windowineditorright 0 margin10mobilesettingget 0 mobilesettinggetwebkittransform scale11new wowfunction thiswaddonsanims3px solid fff1 element44d82a7b0c6c40a995fcb4faa9d2d606padding 0platformelementsettingsxsnonesmnonemdblocklgblockvormwidth 16pxsettimeoutfunction ifthisstartscroll clearintervalthisstartscrollsetupelement88673371964476899448px element44d82a7b0c6c40a995fcb4faa9d2d60640px webkitbordertoprightradius 40pxflexdirectionnav flexnextwplatformelements if typeofpromisethenfunctionveelmargintop 10pxtextoverlay1urlpaddingbottom 20pxbootestimonialauthorboohiddenwidth 100 heighttouchstartborderradiuslgdisplay thatsettingsget xs3thisplaceholderinterval setintervalfunction soboofullwidthslider slidesnextscript wloadedplatformdependenciespushnextscript returnmozborderradiusvar platformelementid17px important6px mozborderradius 6pxauto startinitializewebkitborderradius 6px element44d82a7b0c6c40a995fcb4faa9d2d606mobilesetting true function0 rightelement el10px 0flexprevwindowplatformelementrequire windowrequire reliesthisbootestimonialslidecontentanimateelfindlieqnextslideanimatesetinterval to checkfast else elremoveclassresizedbyheight0 30pxifintersectionwloadedplatformdependenciestextalign center element44d82a7b0c6c40a995fcb4faa9d2d606wloadedplatformdependencies undefinedrotate180degundefined wloadedplatformdependencieselsecallback asyncrequire specificoverflow hidden element44d82a7b0c6c40a995fcb4faa9d2d606false else documentdocumentelementattacheventonpropertychangeinit return waddonsanimationsbackground transparentoverlegwplatformelementsplatformelementid wplatformelementsplatformelementiddeferredobjectborderbox mozboxsizingdetermine which displayelementdefinitionextendsetupelement719830688263915464solid trans element44d82a7b0c6c40a995fcb4faa9d2d606bootestimonialsliderstyle15 1 2platformelementextend update functionloadscripturltosomescriptjswaddonsanimsmarketplaceeditmysitecomuploadsbmarketplaceelements874959678356211109101assets new elementpointerif width 768hidebox platformelementextend20px paddingleft 30pxbooslidecaptionschoneveld eigenaardisplayinitialize function returnleft element44d82a7b0c6c40a995fcb4faa9d2d606relative borderfunction return coloredboxtypemobilesettingget falsemobilesetting init returnmobilesetting falsecenter element08b8520687984c6fa1cfea8658e83ecaelementdefinitionextend initializecolor 534040 importantrequirefunc windowplatformelementrequirebodyaddclassanimationsincluded jquery function26px heightstovestop thisbootestimonialsliderhoverfunction ifthisstartscroll874959678356211109101userselect none20px positioninstallresizehandler function window5pxbootestimonialsliderstyle2function holdwidthstartelementheights thisbootestimonialslidecontentanimate heightmooierate of 15fpshideboxcontent mozboxsizing borderboxrenderingbody ifbody if mobilesettinggetholdunderscorethisouterheight getelement08b8520687984c6fa1cfea8658e83eca arrowstyle5 flexdirectionnavheight 16px background4 5 1if typeofboofullwidthslider margin 0pxbootestimonialavatar displaymaxheight25 elsehidebox hideboxcontentthatsettingsget lgcall it untilvar elementdefinition functionautodependencieslengthwwreturn hidebox if0 wplatformelementsplatformelementiddeferredobjectresolve0 10pxtypeof elementdefinition undefinednew platformelementsettingsxsnonesmnonemdblocklgblock elementprototypesettingspageelementidbodyhasclassanimationsincluded head linkrelstylesheetfirstbeforedependencieslength reducedependencies functionpromisereturnall 03surlmarketplaceeditmysitecomuploadsbmarketplaceelements294973650257440885116assetsarrowstyle3nextpng norepeat centermobilesetting truenextslide1200 display thatsettingsgetcallback async truemedia onlyh2 element08b8520687984c6fa1cfea8658e83ecawanalyticsspcontextsleft width 100dontarrowsizemediumdependencieslength 0element08b8520687984c6fa1cfea8658e83eca arrowstyle3head linkrelstylesheetfirstbefore1sirwrelative textalignactualresizehandler will execute10pxelfindlieqnextslideanimate heightfunctionpromise nextscript wloadedplatformdependenciespushnextscriptparagraph paddingleft40px borderbottomrightradiusmozborderbottomleftradius 40px100 mozboxsizingheeft848857247979793891101 ifresliding settimeoutfunctiondisplay inlineblock element44d82a7b0c6c40a995fcb4faa9d2d606inclwplatformelementsplatformelementiddeferredobjectresolve wplatformelementsplatformelementiddeferredpromisedonefunction varif typeof someobjectwplatformelements ifbootestimonialmapfunctionthissettingsgetmobiletrue varelementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplaceelements874959678356211109101assetslinkrelstylesheetfirstbefore waddonsanimationssheetnotimportant fontsizewomanwise 1null var100 height 100mijnmediaalstypeof someobject undefinedwidth 16px heightleft topwebkitboxsizing borderbox msboxsizingbooslidecontent paragraph paddingleftwplatformelementsplatformelementiddeferredobjectpromise ifintersectionwloadedplatformdependenciesinitialize function thiswaddonsanims16px heightplaceholderspaddingtop 20pxboofullwidthslidershowloading1 minheightdisplay valuebeen replaced thisplaceholderintervalheight ch100typeof someobjectcoloredbox platformelementextendpaddingbottommstransitionvar body bodyelse if documentcreateeventtextoverlay1 booslidecontent paragraphtextalign righteigenaar womanwisecursor pointerelement08b8520687984c6fa1cfea8658e83eca arrowsizemediumtricksnaarmozborderbottomrightradius 40px borderbottomrightradiuslicenter borderradius 100pxdeferred wplatformelementsplatformelementiddeferredpromisewglobal underscore jqueryelement08b8520687984c6fa1cfea8658e83eca boofullwidthsliderfullheight1var coloredboxborderradius 100px mozborderradiusblock position16element08b8520687984c6fa1cfea8658e83eca boofullwidthsliderfullheight1 slidesborderradius 10pxbootestimonialavatarimgcontent displayvar requirefunc windowplatformelementrequirethissettingsgetmobiletruethisheight30px paddingrightsetupelement682182910974229486flexnext background transparentmozboxsizing borderboxdependencies null varvisible function ifneed to resizecenter center borderradiusfunction var coloredboxwaddonsanimationblock visibilityajaxwidth get screenmarginthatupdatewebkitborderradius 100pxplaceholders if thisplatformelementchildplaceholderlengthrequirefunc wglobal underscoretypeof documentdocumentelementappready995909419681669705 elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplaceelements874959678356211109101assetselremoveclassresizedbyheightposition absolute leftundefinedrotate180deg transformwplatformelements undefined wplatformelementsthisbootestimonialslidecontent bootestimonialmapfunction returnsettimeout functioncss display displaytextindentif widthsolid trans backgroundtransform scale11removeelement08b8520687984c6fa1cfea8658e83eca flexcontrolpaging lielement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialsliderstyle4ignore resizearrowstyle5typeof wloadedplatformdependencies undefinedhetnone mozuserselectbeen replaced20px 20pxdisplay thatsettingsget mdutilplatformelementsplatformelement utilplatformelementsplatformelementsettingsrightmozborderradius 6px webkitborderradius16px height 16pxthisconstructorsuperinitializeapplythisclearintervalthisstartscroll thisstartscroll setintervalfunctionifinstallresizehandlerelement08b8520687984c6fa1cfea8658e83eca boofullwidthslidershowloading1var displayheight25datatypeimgauto important0 if documentdocumentelementappreadyslides booimage imgtextindent 9999pxso use setintervalscale11 transform100 zindexsmignore resize eventsthisplatformelementchildplaceholderlength 00 0 30pxelement08b8520687984c6fa1cfea8658e83eca boofullwidthsliderbootestimonialauthor h4loadscript function urldependencies nullmozboxsizing borderbox webkitboxsizingalldithermine schoneveldrequiredarrowsizesmallelse elremoveclassresizedbyheight elfindflexviewportanimatebootestimonialavatarafter borderbottomrotate180deg moztransformbootestimonialavatar display nonetype platformelementflexdirectionnav flexnext backgroundexecutionthisouterheight get varstill wantwidth window width6bordertoprightradiusscale11 webkittransform scale11true bodyaddclassanimadded ifelementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplaceelements874959678356211109101assets newmarketplaceeditmysitecomuploadsbmarketplaceelements848857247979793891101assets new elementvar waddonsanimations platformelementextendboofullwidthsliderresizedbyheight slidesjouwsetupelement423808124116221957hidden function ifimportant fontsize 17px40px webkitborderbottomrightradiusmstransformbtwdieappreadyfunction var displayuse width get20px paddingleftmakencenter element44d82a7b0c6c40a995fcb4faa9d2d606534040 important fontsizeopacity 1deferredikwanalyticsdocumentdocumentelementattacheventonpropertychange functioneventbodyreturn getscriptnextscript promisethenfunctionresizetimeout null resizetimeoutscale11 element44d82a7b0c6c40a995fcb4faa9d2d606eventsrotate180deg moztransform scale11thiswaddonsanims waddonsanimsflexcontrolpagingmobilesetting false elsemoztransformflexprev backgroundbooimage img widthsetintervalfunction thisnext thisautoslide1000resize the elementeladdclassresizedbyheight elfindflexviewportanimate height0 autoelfindflexactiveslidevar hideboxcenter borderradiusdoeflexdirectionnavthisnext thisautoslide1000 mathroundthisautoslide21000borderbottomleftradius 40px webkitborderbottomrightradiusreturn waddonsanimationsurl httpscdnjscloudflarecomajaxlibswow112wowminjs datatypezijnsetinterval874959678356211109101 ifwindowrequire reliescontent positionifthisequalheight var elementheights10px mozborderradius 10pxthisstartyjeelement7816d8dd29514b2dbe1c1546198c4594true20px element44d82a7b0c6c40a995fcb4faa9d2d606screen width widthtransformelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialauthor h4eenmarketplaceeditmysitecomuploadsbmarketplaceelements971000768590423757101assets new elementtypeof wplatformelementsfast elfindlieqnextslidefindbooimage imganimatefunction if bodyhasclassanimationsincludedsetupelement65508483569560695324pxdocumentdocumentelementappready undefinedsuccess callback40px971000768590423757101xsthatupdate initializeupdateimg positionresizetimeout settimeoutpromisethenfunction return getscriptnextscriptnorepeat centerbootestimonialavatarimagewplatformelementsplatformelementiddeferredobjectwebkittransition allhidebox ifhoweverbooslidecontent h21s easeborderradius 100px16px background transparentwidth 99240px mozbordertoprightradiustouchmove40px bordertoprightradius 40px17px important element44d82a7b0c6c40a995fcb4faa9d2d606resizetimeout null hideboxch100 fast40px borderbottomleftradiusthisbootestimonialslidecontent bootestimonialmapfunction1px contentwebkitbordertoprightradius 40px mozbordertoprightradiuswebkittransform rotate180deg995909419681669705 elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplaceelements848857247979793891101assetsrocket stovewplatformelementsplatformelementiddeferredpromise wplatformelementsplatformelementiddeferredobjectpromise ifintersectionwloadedplatformdependenciesmargin 0px 0undefined wloadedplatformdependencies ifmargintopnone important element44d82a7b0c6c40a995fcb4faa9d2d606img widthwidth 992 displaytypeof elementdefinitioninitialize function definedplaceholders haveheight 16pxthisnextthatsettingsget mdmarketplaceeditmysitecomuploadsbmarketplaceelements874959678356211109101assetstmpheightthisstartscroll function holdborderradius 6pxpaddingleft 30px paddingrightelse if widthbackbone platformelementresize18both float lefturl httpscdnjscloudflarecomajaxlibswow112wowminjsborderbox webkitboxsizing1 element08b8520687984c6fa1cfea8658e83ecawaddonsanimations platformelementextend initializetypeof wplatformelementsplatformelementidthisstartscroll setintervalfunction thisnextelse ifimportant zindexotransitionelementheightsif typeof documentdocumentelementappreadytop 48px element44d82a7b0c6c40a995fcb4faa9d2d606var maxheightheight 1px contentelfindlieqnextslidefindbooimage imganimate heightfast elsebootestimonialcontrols100 elementprototypesettings newmsboxsizing borderbox boxsizingmobilesettinggettrue bodyaddclassanimaddedwebkitborderradius 100px element08b8520687984c6fa1cfea8658e83ecasolid fff borderradius50 autoreplaced thisplaceholderintervaltrue functionif mobilesettinggetelement renderingcallvar waddonsanimationswindowineditor windowineditornull resizetimeout settimeout40px borderbottomrightradius 40pxwebkitborderbottomrightradius 40px mozborderbottomrightradiushebtekstheight 12pxremove bodyaddclassanimationsincludedblock element44d82a7b0c6c40a995fcb4faa9d2d60613rocket stove storemoztransform scale11 webkittransformmobilesetting varfast elfindlieqnextslideanimate heightrotate180deg transform rotate180degstove storemaxwidthgonneke berendsenbindthis 100 elementprototypesettingsopacityfontsize 17px importantreliesutilplatformelementsplatformelementsettingsih fastthiswaddonsanims534040 importantscale11 otransformajax url httpscdnjscloudflarecomajaxlibswow112wowminjstrans element44d82a7b0c6c40a995fcb4faa9d2d606elementundefined wplatformelementsplatformelementidrequirefuncwidth 100 mozboxsizingsetupelement45888693653794734040px webkitborderbottomleftradiuselse varthisbootestimonialslidecontentanimate height maxheight25backbone platformelement platformelementsettingsmozbordertoprightradius 40px bordertoprightradiusresize functionunderscore jquerynorepeat element08b8520687984c6fa1cfea8658e83ecanone element08b8520687984c6fa1cfea8658e83ecaborderbottomrightradius 40px steplogovar mobilesetting vartypeof wplatformelementsplatformelementid undefinedreturn promisethenfunction return12px background transparentvar bodyhidden element44d82a7b0c6c40a995fcb4faa9d2d606position relativemaxheight mathmaxapplynull elementheightsnoneresizetimeout nullarrowstyle3marketplaceeditmysitecomuploadsbmarketplaceelements848857247979793891101assets newcoloredboxpositionelementdefinitionextend initialize functiondezeelementdefinition platformelementextend vardiscoverrootdomainelements requirefunc wglobal992 displaywindowplatformelementrequireurlmarketplaceeditmysitecomuploadsbmarketplaceelements294973650257440885116assetsarrowstyle3nextpngwebkitbordertopleftradius 40pxloadscripturltosomescriptjs function newgetscriptnextscriptwidth 100contentall 1s easeplaceholders have been0 10px 10pxbordertoprightradius 40pxheight 1pxwebkitbordertoprightradius 40pxfunctiontimewebkitboxsizing borderboxminheight 100px0 positioncolorbootestimonialauthor h4 paragraph17possible type platformelementwplatformelementsplatformelementidwebkituserselect nonefunction thatupdatewidth 26px heightoverflow hiddensetupelement872193193373722382we dont wantscale11 otransform scale11successcoloredbox platformelementextend initializebootestimonialsliderstyle5userselectheight ih40px bordertopleftradiusvanso useasync true bodyaddclassanimaddedinlineblock element44d82a7b0c6c40a995fcb4faa9d2d606mstransform scale11 transformfunction var waddonsanimationseventpropertynameelement08b8520687984c6fa1cfea8658e83eca boofullwidthslidershowloading1 minheightwplatformelementswhich display value100vhabsoluteportfoliobootestimonialcontentwrapelementdefinition functionplatformelementextendfunction window resizesetintervalfunction so usemozuserselect nonefunction if26pxright 0fontsize 17pxsetupelement78308132452622382750pxwebkitborderradius 10pxmoztransition allelse documentdocumentelementattacheventonpropertychange functioneventwindowwidth10px solid transuse setintervalborderbox webkitboxsizing borderboxelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialsliderstyle7false elseelement08b8520687984c6fa1cfea8658e83eca flexcontrolpaging66ms the actualresizehandlercheckwebkitbordertopleftradius 40px mozbordertopleftradiusmobile5 1bootestimonialslider bootestimonialcontrolswplatformelementsplatformelementiddeferredpromisedonefunction varvisibility hidden functionsetupelement185380242869405941documentcreateevent documentaddeventlistener documentaddeventlistenerappreadyresizetimeoutborder 3pxreducedependencies functionpromise nextscriptminheightreducedependencies functionpromisevisibility visiblebody bodywantoverflowurlmarketplaceeditmysitecomuploadsbmarketplaceelements294973650257440885116assetsarrowstyle3nextpng norepeateigenaar womanwise 1border 0px solidmsboxsizing borderboxfunction ignoretop 20pxfunction if bodyhasclassanimaddedelse displaymargin 0pxmstransform scale110 mobilesettinggetwebkitborderradiusbackgroundsizearrowsizelarge flexdirectionnavundefined typeof elementdefinitiondeel0 0 6pxthatactualresizehandler 66 66mselements display thatupdatereturn hideboxmobilesettingget thissettingsgetmobiletrue varmaxheight25null thatactualresizehandler 66important element44d82a7b0c6c40a995fcb4faa9d2d606elfindflexviewportanimatecenter0 auto importantli displaymozborderradius 100px webkitborderradiusscale11 mstransform scale1116px backgroundscreenevents as long0pxelementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplaceelements971000768590423757101assetsbodyhasclassanimadded loadscript functionthisbootestimonialsliderhoverfunctionwglobal underscoreelementprototypesettings new platformelementsettingsxsnonesmnonemdblocklgblocktime to reslidingcoloredboxcontent10px 10pxhermine40px webkitborderbottomrightradius 40pxtrans height 1pxex btwh3position absolute widthall 03s easeinoutgetscriptnextscript promisethenfunction wplatformelementsplatformelementiddeferredobjectresolveelement10ed8a63267b4088ada13b67f393f5d2h2 element08b8520687984c6fa1cfea8658e83eca textoverlay1wplatformelementsplatformelementid undefinedfocus concept creatiethisautoslide1000waddonsanimations if typeofhttpscdnjscloudflarecomajaxlibswow112wowminjs datatype scriptboth float100px mozborderradiuspromisethenfunction return30px element44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialsliderstyle6else mobilesetting true9waddonsanims function varglobal require specifictransform scale11 element44d82a7b0c6c40a995fcb4faa9d2d606wloadedplatformdependencies ifrelative importantmd elsetekstenfeeimganimate height ihelement08b8520687984c6fa1cfea8658e83eca textoverlay1element08b8520687984c6fa1cfea8658e83eca boofullwidthslider slides20px importantbodyhasclassanimaddedundefined wplatformelementsplatformelementid wplatformelementsplatformelementiddeferredobjectwebsitevar platformelementid 848857247979793891101wplatformelementsplatformelementiddeferredpromisedonefunction40px bordertoprightradiusplatformelementid 874959678356211109101display none element44d82a7b0c6c40a995fcb4faa9d2d6061 2bodyaddclassanimationsincluded jquery1middlewindow widthborder 0pxfunction returnmozuserselect none ouserselect100px webkitborderradiusbsresizebeeldelement08b8520687984c6fa1cfea8658e83eca boofullwidthslider marginborder 3px solidneedtype platformelement functionboofullwidthsliderfullheight1 slidesthisplatformelementchildplaceholderlengthvar maxheight mathmaxapplynullplatformelementfloatloadscript functionnorepeat center center15textalignif thisplatformelementchildplaceholderlengthbooslidecontent paragraphsuccess callback asyncflexprev background transparentelement24653960d5704031bda3c9bd4ca9414cmsboxsizing800ms cubicbezier07700000017510006px 6px2coloredboxcontent clearfirstdependencieslength dependencieslength reducedependencieselement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialsliderstyle3wplatformelementsplatformelementiddeferredobjectpromiseuse widthelementprototypesettingsscale11hidden functionthisautoslide1000 ifthisstoponhover hoverifthisequalheightelement08b8520687984c6fa1cfea8658e83eca booimageifthisstartscroll clearintervalthisstartscroll consolelogstopelse var heightajax urlmijignorebootestimonialsliderstyle6 bootestimonialauthorfunctionevent if eventpropertynameif width 992200pxhideboxcontent mozboxsizing120 top 0documentaddeventlistener documentaddeventlistenerappready3pxfunctionpromisesetintervalfunctionheight maxheight25 elsereplacedhidebox if typeofimportant element44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialauthorif documentcreateeventvar heightnull thatactualresizehandlerdeveloper however webodyaddclassanimadded if typeoffunction varelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialsliderstyle2else elremoveclassresizedbyheightwplatformelementsplatformelementid undefined wplatformelementsplatformelementidabsolute left 0creatie portfolioflexnext backgroundsamenfunction resizetimeoutbordertopleftradius 40px0px solid transbackbone utilplatformelementsplatformelement utilplatformelementsplatformelementsettingsplatformelement platformelementsettings varthisbootestimonialslidecontent0 mobilesettingget false100 element44d82a7b0c6c40a995fcb4faa9d2d606developerthatactualresizehandler 66global requirechotransformtoppadding 0 importanttrack15fps actualresizehandlerfunction thatupdate initialize3 4 5webkitborderbottomleftradiusa82e2ethisnext thisautoslide100019elementheights thisbootestimonialslidecontentcallback ajax urlfffwidth 26pxfunctionenull resizetimeout0 clearintervalthisplaceholderintervalwloadedplatformdependencies if typeofthisconstructorsuperinitializeapplythis bindthis100 elementprototypesettingswhich displayheadwidth 120030px element44d82a7b0c6c40a995fcb4faa9d2d606init returnslides booimagezielbindthis 100someobject undefined971000768590423757101 if typeofinlineblock16pxbackgroundpositionflexnext background ffftransitionjquery40px bordertopleftradius 40pxelement08b8520687984c6fa1cfea8658e83eca arrowsizelargeelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialslider8203ikkhtmluserselectif bodyhasclassanimadded loadscript6px webkitborderradiusslidesbootestimonialcontent768 display thatsettingsgetelement44d82a7b0c6c40a995fcb4faa9d2d606 bootestimonialjquery functiondeveloper howeverwidth 768 display100 autoplatformelementid 848857247979793891101 ifvar elementheights thisbootestimonialslidecontentheight ch100 fastundefined wplatformelements ifbootestimonialmapfunction return thisouterheightflexviewport minheightwenstlinkrelstylesheetfirstbeforeplatformelementextend varmozuserselectwomanwise 1 26px webkitborderradius 6pxsetupelement992196968636951218elfindflexviewportanimate height ch100color 534040thisstartxdeterminedisplay nonenull20px paddingbottom 20pxif typeof wplatformelementsblock position absoluteupdate function varsiteplatformelementid 874959678356211109101 ifboththisnext thisautoslide1000 ifthisstoponhovernone ouserselect nonewplatformelementsplatformelementiddeferredobject newbootestimonialquotebefore0px 0coloredbox ifwebkittransform rotate180deg transformmozborderradius 10pxbootestimonialcontrols positionelement08b8520687984c6fa1cfea8658e83eca arrowsizesmall flexdirectionnavfalse mobilesettingposition relative element08b8520687984c6fa1cfea8658e83ecaarrowsizemedium flexdirectionnavboofullwidthsliderresizedbyheightrelative overflowelfindflexviewportanimate height1 2 3utilplatformelementsplatformelementsettings function wmarketplaceeditmysitecomuploadsbmarketplaceelements971000768590423757101assets newxs else ifborderbox boxsizing borderboxtop 0gesprekimportant zindex 1bootestimonialauthor h3768 displaywplatformelementsplatformelementiddeferredobjectresolve ifpossiblevar mobilesettingget thissettingsgetmobiletruescale11 transform scale11elementheights thisbootestimonialslidecontent bootestimonialmapfunction0 element44d82a7b0c6c40a995fcb4faa9d2d606wplatformelementsplatformelementiddeferredpromisedonefunction var elementdefinitionleft 20px topelement08b8520687984c6fa1cfea8658e83eca flexdirectionnavfunction var current40px stepbooimage imgbootestimonialauthornew element elthatsettingsget xsvar platformelementid 9710007685904237571017else documentdocumentelementattacheventonpropertychangeomplatformelementextend initialize functionnull var elementdefinitionwebkitbordertopleftradiusimganimate height ch100bootestimonialavatar img positioncallbackessentiecreatiefalse mobilesetting falseparagraph element44d82a7b0c6c40a995fcb4faa9d2d606if eventpropertyname appreadyifthisstartscrollmathroundthisautoslide21000if resizetimeoutcsselementdefinition platformelementextendmoztransitionwat jeelementprototypeelementidmaxwidth none importantclearintervalthisplaceholderinterval thisconstructorsuperinitializeapplythissetupelement480485496583333535window width determinefunction wegetscriptnextscript promisethenfunctionelse mobilesettingborderboxhover to stopreplaced thisplaceholderinterval setintervalfunctionwe stillthatinstallresizehandlerboofullwidthsliderif eventpropertynameresizes thatinstallresizehandlerfunctionevent ifbooslidecontenttransition allihff5b4fimportant bottomstore30px paddingright 30pxplatformelementid 848857247979793891101mathmaxapplynull elementheightsotransform scale11 mstransformel03s easeinoutvar mobilesettingblockleft top norepeatclearintervalthisplaceholderintervalif dependencieslength 032pxtransform rotate180deg moztransformmstransform rotate180deg webkittransform3sthisstartscroll functionwaddonsanimationssheetnot first

Longtail Keyword Density for Visueel.online

KeywordsOccurences
want to call34
no-repeat center center26
3 4 523
2 3 423
1 2 323
documentdocumentelementappready 0 if17
undefined documentdocumentelementappready 017
documentdocumentelementappready undefined documentdocumentelementappready17
typeof documentdocumentelementappready undefined17
if typeof documentdocumentelementappready17
new element el17
been replaced thisplaceholderinterval17
elementprototypesiteid 995909419681669705 elementprototypeassetspath17
0 if documentdocumentelementappready17
elementprototypeuserid 9601675 elementprototypesiteid17
100 elementprototypesettings new17
bindthis 100 elementprototypesettings17
thisconstructorsuperinitializeapplythis bindthis 10017
clearintervalthisplaceholderinterval thisconstructorsuperinitializeapplythis bindthis17
9601675 elementprototypesiteid 99590941968166970517
documentdocumentelementappready windowineditor windowineditor17
if documentdocumentelementappready windowineditor17
thisplatform-element-child-placeholderlength 0 clearintervalthisplaceholderinterval17
else if documentcreateevent17
if documentcreateevent documentaddeventlistener17
documentcreateevent documentaddeventlistener documentaddeventlistenerappready17
false else documentdocumentelementattacheventonpropertychange17
else documentdocumentelementattacheventonpropertychange functionevent17
documentdocumentelementattacheventonpropertychange functionevent if17
functionevent if eventpropertyname17
if eventpropertyname appready17
wplatformelementsplatformelementiddeferredpromisedonefunction var elementdefinition17
wplatformelementsplatformelementiddeferredobjectresolve wplatformelementsplatformelementiddeferredpromisedonefunction var17
0 wplatformelementsplatformelementiddeferredobjectresolve wplatformelementsplatformelementiddeferredpromisedonefunction17
dependencieslength 0 wplatformelementsplatformelementiddeferredobjectresolve17
if dependencieslength 017
0 clearintervalthisplaceholderinterval thisconstructorsuperinitializeapplythis17
check for placeholders17
if thisplatform-element-child-placeholderlength 017
we still want17
undefined typeof elementdefinition17
elementdefinition undefined typeof17
typeof elementdefinition undefined17
if typeof elementdefinition17
null var elementdefinition17
var elementdefinition platformelementextend17
elementdefinition platformelementextend var17
platformelementextend var element17
var element elementdefinitionextend17
element elementdefinitionextend initialize17
elementdefinitionextend initialize function17
initialize function we17
function we still17
call the initialize17
placeholders if thisplatform-element-child-placeholderlength17
initialize function defined17
developer however we17
however we dont17
we dont want17
call it until17
until placeholders have17
placeholders have been17
have been replaced17
replaced thisplaceholderinterval setintervalfunction17
thisplaceholderinterval setintervalfunction so17
setintervalfunction so use17
so use setinterval17
setinterval to check17
promisethenfunction wplatformelementsplatformelementiddeferredobjectresolve if17
wplatformelementsplatformelementiddeferredobjectresolve if dependencieslength17
getscriptnextscript promisethenfunction wplatformelementsplatformelementiddeferredobjectresolve17
elementdefinition null var17
utilplatformelementsplatformelementsettings function w17
wloadedplatformdependencies undefined wloadedplatformdependencies17
typeof wloadedplatformdependencies undefined17
if typeof wloadedplatformdependencies17
return getscriptnextscript promisethenfunction17
null var platformelementid17
dependencies null var17
var dependencies null17
platformelementsettings var dependencies17
platformelement platformelementsettings var17
backbone platformelement platformelementsettings17
w backbone platformelement17
function w backbone17
utilplatformelementsplatformelement utilplatformelementsplatformelementsettings function17
wloadedplatformdependencies if typeof17
backbone utilplatformelementsplatformelement utilplatformelementsplatformelementsettings17
jquery backbone utilplatformelementsplatformelement17
underscore jquery backbone17
w-global underscore jquery17
requirefunc w-global underscore17
elements requirefunc w-global17
platform elements requirefunc17
specific to platform17
global require specific17
windowplatformelementrequire windowrequire relies17
requirefunc windowplatformelementrequire windowrequire17
var requirefunc windowplatformelementrequire17
undefined wloadedplatformdependencies if17
typeof elementdefinition null17
if typeof wplatformelements17
new deferred wplatformelementsplatformelementiddeferredpromise17
nextscript wloadedplatformdependenciespushnextscript return17
wloadedplatformdependenciespushnextscript return promisethenfunction17
typeof wplatformelements undefined17
dependencieslength reducedependencies functionpromise17
dependencieslength dependencieslength reducedependencies17
return promisethenfunction return17
ifintersectionwloadedplatformdependencies dependencieslength dependencieslength17
wplatformelementsplatformelementiddeferredobjectpromise ifintersectionwloadedplatformdependencies dependencieslength17
wplatformelementsplatformelementiddeferredpromise wplatformelementsplatformelementiddeferredobjectpromise ifintersectionwloadedplatformdependencies17
deferred wplatformelementsplatformelementiddeferredpromise wplatformelementsplatformelementiddeferredobjectpromise17
wplatformelementsplatformelementiddeferredobject new deferred17
functionpromise nextscript wloadedplatformdependenciespushnextscript17
wplatformelementsplatformelementid wplatformelementsplatformelementiddeferredobject new17
undefined wplatformelementsplatformelementid wplatformelementsplatformelementiddeferredobject17
wplatformelementsplatformelementid undefined wplatformelementsplatformelementid17
typeof wplatformelementsplatformelementid undefined17
promisethenfunction return getscriptnextscript17
if typeof wplatformelementsplatformelementid17
wplatformelements if typeof17
undefined wplatformelements if17
wplatformelements undefined wplatformelements17
reducedependencies functionpromise nextscript17
border-box box-sizing border-box15
border-box -ms-box-sizing border-box15
border-box -webkit-box-sizing border-box15
-moz-box-sizing border-box -webkit-box-sizing15
-ms-box-sizing border-box box-sizing15
-webkit-box-sizing border-box -ms-box-sizing15
platformelementextend initialize function13
border-radius 100px -moz-border-radius13
100px -moz-border-radius 100px13
-moz-border-radius 100px -webkit-border-radius13
100px -webkit-border-radius 100px13
important element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialauthor13
flex-direction-nav flex-next background12
element-08b85206-8798-4c6f-a1cf-ea8658e83eca textoverlay-1 booslidecontent12
flex-direction-nav flex-prev background12
display none element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d60611
-webkit-border-radius 100px element-08b85206-8798-4c6f-a1cf-ea8658e83eca10
center center element-08b85206-8798-4c6f-a1cf-ea8658e83eca10
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialauthor h410
elementdefinition function var10
var elementdefinition function10
height ch100 fast9
left top no-repeat9
top no-repeat element-08b85206-8798-4c6f-a1cf-ea8658e83eca9
li a width9
height ih fast9
flex-direction-nav a width9
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialauthor h39
thiswaddonsanims waddonsanims function8
function var waddonsanimations8
var waddonsanimations platformelementextend8
waddonsanimations platformelementextend initialize8
initialize function thiswaddonsanims8
function thiswaddonsanims waddonsanims8
return waddonsanimations if8
waddonsanims function var8
thissettingsgetmobiletrue var body8
var mobilesetting var8
mobilesetting var mobilesettingget8
var body body8
var mobilesettingget thissettingsgetmobiletrue8
mobilesettingget thissettingsgetmobiletrue var8
waddonsanimations if typeof8
flex-prev background transparent8
971000768590423757-101 if typeof8
head linkrelstylesheetfirstbefore waddons-animations-sheetnot8
color 534040 important8
function if bodyhasclassanimations-included8
if bodyhasclassanimations-included head8
position absolute left8
center center border8
bodyhasclassanimations-included head linkrelstylesheetfirstbefore8
linkrelstylesheetfirstbefore waddons-animations-sheetnot first8
platformelementid 971000768590423757-101 if8
waddons-animations-sheetnot first remove8
first remove bodyaddclassanimations-included8
flex-next background transparent8
remove bodyaddclassanimations-included jquery8
body if mobilesettingget8
var platformelementid 971000768590423757-1018
body body if8
function var mobilesetting8
if mobilesettingget 08
typeof someobject undefined8
script success callback8
success callback async8
callback async true8
mobilesettingget 0 mobilesettingget8
async true bodyaddclassanim-added8
else if width8
bodyaddclassanim-added if typeof8
if typeof someobject8
someobject undefined loadscripturltosomescriptjs8
httpscdnjscloudflarecomajaxlibswow112wowminjs datatype script8
undefined loadscripturltosomescriptjs function8
loadscripturltosomescriptjs function new8
function new wow8
new wow mobile8
wow mobile mobilesetting8
mobile mobilesetting init8
mobilesetting init return8
init return waddonsanimations8
datatype script success8
true bodyaddclassanim-added if8
url httpscdnjscloudflarecomajaxlibswow112wowminjs datatype8
ajax url httpscdnjscloudflarecomajaxlibswow112wowminjs8
marketplaceeditmysitecomuploadsbmarketplace-elements-971000768590423757-101assets new element8
elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplace-elements-971000768590423757-101assets new8
995909419681669705 elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplace-elements-971000768590423757-101assets8
0 mobilesettingget false8
mobilesettingget false mobilesetting8
false mobilesetting false8
mobilesetting false else8
false else mobilesetting8
else mobilesetting true8
mobilesetting true function8
true function if8
function if bodyhasclassanim-added8
bodyhasclassanim-added loadscript function8
callback ajax url8
url callback ajax8
function url callback8
loadscript function url8
if bodyhasclassanim-added loadscript8
type platformelement function7
border 0px solid7
0px solid trans7
required for element7
position absolute width7
platformelement function var7
possible type platformelement7
0 margin 06
center border 3px6
media only screen6
screen and max-width6
fff border-radius 100px6
solid fff border-radius6
3px solid fff6
border 3px solid6
4 5 16
center center border-radius6
slides booimage img6
5 1 26
content display block6
thisstartscroll setintervalfunction thisnext6
ifthisstartscroll clearintervalthisstartscroll thisstartscroll6
clearintervalthisstartscroll thisstartscroll setintervalfunction6
setintervalfunction thisnext thisautoslide10006
0 0 10px5
absolute left 05
width 100 height5
100 height 1005
textoverlay-1 booslidecontent h25
textoverlay-1 booslidecontent paragraph5
-ms-transform rotate180deg -webkit-transform5
rotate180deg -webkit-transform rotate180deg5
rotate180deg transform rotate180deg5
-webkit-transform rotate180deg transform5
all 800ms cubic-bezier07700000017510005
all 1s ease5
text-align center element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6065
all 03s ease-in-out5
margin 0 auto5
none important element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6065
534040 important element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6065
solid trans background5
bodyaddclassanimations-included jquery function5
scale-11 -webkit-transform scale1-14
element-08b85206-8798-4c6f-a1cf-ea8658e83eca flex-control-paging li4
-webkit-transform scale1-1 -o-transform4
scale1-1 -o-transform scale1-14
0 position absolute4
-moz-transform scale-11 -webkit-transform4
30px element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialsliderstyle-64
-o-transform scale1-1 -ms-transform4
-ms-transform scale1-1 transform4
scale1-1 -ms-transform scale1-14
element-08b85206-8798-4c6f-a1cf-ea8658e83eca arrowstyle-5 flex-direction-nav4
opacity 1 background4
urlmarketplaceeditmysitecomuploadsbmarketplace-elements-294973650257440885-116assetsarrow-style-3-nextpng no-repeat center4
scale1-1 transform scale1-14
transform scale1-1 element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6064
1px solid trans4
26px height 20px4
center border-radius 100px4
urlmarketplaceeditmysitecomuploadsbmarketplace-elements-294973650257440885-116assetsarrow-style-3-prevpng no-repeat center4
element-08b85206-8798-4c6f-a1cf-ea8658e83eca arrowstyle-3 flex-direction-nav4
534040 important font-size4
solid trans element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6064
width 26px height4
bootestimonialavatar img position4
border-radius 6px -moz-border-radius4
waddons-animation-block visibility visible4
visibility visible function4
visible function if4
trans background trans4
relative border 0px4
img position relative4
fast elfindlieqnextslidefindbooimage imganimate4
position relative important4
position relative border4
border-bottom 1px solid4
height 1px content4
17px important element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6064
font-size 17px important4
elfindlieqnextslidefindbooimage imganimate height4
fast elfindlieqnextslideanimate height4
width 16px height4
-webkit-border-radius 6px element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6064
left 0 right4
0 right 04
right 0 margin4
important font-size 17px4
content position absolute4
10px solid trans4
6px -webkit-border-radius 6px4
6px -moz-border-radius 6px4
-moz-border-radius 6px -webkit-border-radius4
booslidecontent h2 element-08b85206-8798-4c6f-a1cf-ea8658e83eca4
h2 element-08b85206-8798-4c6f-a1cf-ea8658e83eca textoverlay-14
booslidecontent paragraph padding-left4
padding-left 30px padding-right4
30px padding-right 30px4
element-08b85206-8798-4c6f-a1cf-ea8658e83eca boofullwidthsliderresizedbyheight slides4
hidebox if typeof4
display thatsettingsget md4
installresizehandler function window4
value of display4
display that hide-box4
value of css4
hide-box css display4
var display value4
function var display4
update function var4
platformelementextend update function4
hidebox platformelementextend update4
css display display4
display display installresizehandler4
display installresizehandler function4
null hidebox platformelementextend4
display to use4
resizetimeout null hidebox4
var hidebox resizetimeout4
function window resize4
window resize function4
function var hidebox4
resize function ignore4
function ignore resize4
ignore resize events4
events as long4
queue if resizetimeout4
if resizetimeout null4
resizetimeout null resizetimeout4
null resizetimeout settimeout4
lg update value4
thatsettingsget lg update4
settimeout function resizetimeout4
sm else if4
width 768 display4
value to use4
which display value4
768 display thatsettingsget4
display thatsettingsget xs4
thatsettingsget xs else4
xs else if4
determine which display4
if width 9924
width 992 display4
992 display thatsettingsget4
display thatsettingsget sm4
thatsettingsget sm else4
if width 12004
use width get4
width 1200 display4
width determine which4
1200 display thatsettingsget4
window width determine4
width window width4
width width window4
thatsettingsget md else4
md else display4
screen width width4
else display thatsettingsget4
get screen width4
display thatsettingsget lg4
width get screen4
use if width4
resizetimeout settimeout function4
874959678356211109-101 if typeof4
focus concept creatie4
hidden function if4
need to resize4
platformelementid 874959678356211109-101 if4
window resizes thatinstallresizehandler4
resizes thatinstallresizehandler return4
thatinstallresizehandler return hidebox4
return hidebox if4
995909419681669705 elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplace-elements-874959678356211109-101assets4
display thatupdate need4
elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplace-elements-874959678356211109-101assets new4
marketplaceeditmysitecomuploadsbmarketplace-elements-874959678356211109-101assets new element4
element-08b85206-8798-4c6f-a1cf-ea8658e83eca boofullwidthslider margin4
element-08b85206-8798-4c6f-a1cf-ea8658e83eca boofullwidthslider slides4
visibility hidden function4
booimage img width4
max-width none important4
waddons-animation-block visibility hidden4
border-box -moz-box-sizing border-box4
resize the element4
hide-box -moz-box-sizing border-box4
actualresizehandler function thatupdate4
function resizetimeout null4
resizetimeout null thatactualresizehandler4
null thatactualresizehandler 664
thatactualresizehandler 66 66ms4
66ms the actualresizehandler4
elements display thatupdate4
rate of 15fps4
15fps actualresizehandler function4
var platformelementid 874959678356211109-1014
box-sizing border-box function4
actualresizehandler will execute4
function thatupdate initialize4
hide-box-content -moz-box-sizing border-box4
update the elements4
hide-box hide-box-content -moz-box-sizing4
if width 7684
thatupdate initialize function4
mathmaxapplynull elementheights thisbootestimonialslidecontentanimate3
hover to stop3
bootestimonialcontrols li clickscroll3
ifthisequalheight var elementheights3
var elementheights thisbootestimonialslidecontent3
elementheights thisbootestimonialslidecontent bootestimonialmapfunction3
elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplace-elements-848857247979793891-101assets new3
995909419681669705 elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplace-elements-848857247979793891-101assets3
thisautoslide1000 ifthisstoponhover hover3
thisbootestimonialsliderhoverfunction ifthisstartscroll clearintervalthisstartscroll3
stop thisbootestimonialsliderhoverfunction ifthisstartscroll3
thisbootestimonialslidecontent bootestimonialmapfunction return3
elementheights thisbootestimonialslidecontentanimate height3
bootestimonialmapfunction return thisouterheight3
return thisouterheight get3
thisnext thisautoslide1000 ifthisstoponhover3
thisbootestimonialslidecontentanimate height height253
else var height3
get var maxheight3
var maxheight mathmaxapplynull3
maxheight mathmaxapplynull elementheights3
maxheight25 else var3
height maxheight25 else3
thisbootestimonialslidecontentanimate height maxheight253
thisouterheight get var3
-webkit-border-bottom-right-radius 40px -moz-border-bottom-right-radius3
ifthisstartscroll clearintervalthisstartscroll consolelogstop3
initialize function return3
40px -webkit-border-top-right-radius 40px3
-webkit-border-top-right-radius 40px -moz-border-top-right-radius3
40px -moz-border-top-right-radius 40px3
-moz-border-top-right-radius 40px border-top-right-radius3
40px border-top-right-radius 40px3
border-top-right-radius 40px -webkit-border-bottom-left-radius3
40px -webkit-border-bottom-left-radius 40px3
-webkit-border-bottom-left-radius 40px -moz-border-bottom-left-radius3
40px -moz-border-bottom-left-radius 40px3
coloredbox if typeof3
return coloredbox if3
function return coloredbox3
coloredbox platformelementextend initialize3
40px border-top-left-radius 40px3
var coloredbox platformelementextend3
function var coloredbox3
848857247979793891-101 if typeof3
platformelementid 848857247979793891-101 if3
var platformelementid 848857247979793891-1013
-moz-border-bottom-left-radius 40px border-bottom-left-radius3
40px border-bottom-left-radius 40px3
border-bottom-right-radius 40px step3
border-bottom-left-radius 40px -webkit-border-bottom-right-radius3
40px border-bottom-right-radius 40px3
-moz-border-bottom-right-radius 40px border-bottom-right-radius3
40px -moz-border-bottom-right-radius 40px3
border-top-left-radius 40px -webkit-border-top-right-radius3
-moz-border-top-left-radius 40px border-top-left-radius3
clearintervalthisstartscroll consolelogstop thisstartscroll3
clear both float3
consolelogstop thisstartscroll function3
thisstartscroll function hold3
hold on 503
50 auto start3
auto start time3
time to re-sliding3
re-sliding settimeoutfunction ifthisstartscroll3
settimeoutfunction ifthisstartscroll clearintervalthisstartscroll3
thisnext thisautoslide1000 mathroundthisautoslide210003
function var current3
var current thisbulletfilteractivedataslide3
40px -webkit-border-bottom-right-radius 40px3
both float left3
40px -moz-border-top-left-radius 40px3
float left width3
left width 1003
width 100 -moz-box-sizing3
100 -moz-box-sizing border-box3
box-sizing border-box background-color3
padding-top 20px padding-bottom3
20px padding-bottom 20px3
padding-bottom 20px padding-left3
20px padding-left 30px3
padding-right 30px -webkit-border-top-left-radius3
30px -webkit-border-top-left-radius 40px3
-webkit-border-top-left-radius 40px -moz-border-top-left-radius3
colored-box-content clear both3
home focus concept3
womanwise 1 23
16px height 16px3
10px -moz-border-radius 10px3
10px -webkit-border-radius 10px3
0 10px 10px3
10px 10px 03
10px 0 03
position absolute bottom3
height 12px background3
12px background transparent3
height 16px background3
flex-prev background fff3
16px background transparent3
position relative element-08b85206-8798-4c6f-a1cf-ea8658e83eca3
left 0 top3
0 top 03
background-size 100 auto3
ih eladdclassresizedbyheight elfindflex-viewportanimate3
eladdclassresizedbyheight elfindflex-viewportanimate height3
elfindflex-viewportanimate height ch1003
imganimate height ch1003
flex-next background fff3
element-08b85206-8798-4c6f-a1cf-ea8658e83eca arrowsize-small flex-direction-nav3
fast else elremoveclassresizedbyheight3
none -khtml-user-select none3
concept creatie portfolio3
creatie portfolio tips3
elementprototypesettings new platformelementsettingsxsnonesmnonemdblocklgblock3
new platformelementsettingsxsnonesmnonemdblocklgblock elementprototypesettingspageelementid3
boofullwidthslider margin 0px3
margin 0px 03
element-08b85206-8798-4c6f-a1cf-ea8658e83eca boofullwidthslidershowloading-1 min-height3
element-08b85206-8798-4c6f-a1cf-ea8658e83eca boofullwidthsliderfullheight-1 slides3
-moz-user-select none -o-user-select3
element-08b85206-8798-4c6f-a1cf-ea8658e83eca arrowsize-medium flex-direction-nav3
none -o-user-select none3
none user-select none3
important element-08b85206-8798-4c6f-a1cf-ea8658e83eca booimage3
important height auto3
width 100 important3
padding 0 important3
0 position relative3
boofullwidthsliderresizedbyheight slides booimage3
element-08b85206-8798-4c6f-a1cf-ea8658e83eca arrowsize-large flex-direction-nav3
ch100 fast else3
else elremoveclassresizedbyheight elfindflex-viewportanimate3
eigenaar womanwise 13
0 auto important3
bootestimonialavatarafter border-bottom 1px3
solid trans height3
trans height 1px3
absolute width 1003
top 48px element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
relative important z-index3
important z-index 13
bootestimonialcontrols position absolute3
auto important bottom3
20px top 20px3
transform rotate180deg -moz-transform3
rotate180deg -moz-transform scale-113
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialsliderstyle-6 bootestimonialauthor3
0 0 30px3
0 0 6px3
0 6px 6px3
rocket stove store3
hermine schoneveld eigenaar3
schoneveld eigenaar womanwise3
position relative text-align3
block position absolute3
elremoveclassresizedbyheight elfindflex-viewportanimate height3
bootestimonialavatar display none3
elfindflex-viewportanimate height ih3
imganimate height ih3
overflow hidden element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
none element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialslider3
position relative overflow3
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialslider bootestimonialcontrols3
-webkit-border-radius 100px element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
0 important element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
display none important3
display block position3
display inline-block element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
bootestimonialauthor h3 paragraph3
paragraph element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialauthor3
bootestimonialauthor h4 paragraph3
f8a9a9 important element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
display block element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
background trans border-radius3
trans border-radius 6px3
left 20px top3
marketplaceeditmysitecomuploadsbmarketplace-elements-848857247979793891-101assets new element3
if typeof93
initialize function51
null var35
typeof elementdefinition34
function var34
var elementdefinition34
position relative28
center center26
background transparent26
no-repeat center26
else if25
false else25
important element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d60625
4 523
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialauthor23
position absolute23
3 423
1 223
2 323
width 10020
display block18
display none18
we dont17
dont want17
until placeholders17
placeholders have17
have been17
been replaced17
replaced thisplaceholderinterval17
thisplaceholderinterval setintervalfunction17
setintervalfunction so17
elementprototypesiteid 99590941968166970517
eventpropertyname appready17
so use17
use setinterval17
995909419681669705 elementprototypeassetspath17
placeholders if17
if thisplatform-element-child-placeholderlength17
thisplatform-element-child-placeholderlength 017
0 clearintervalthisplaceholderinterval17
clearintervalthisplaceholderinterval thisconstructorsuperinitializeapplythis17
still want17
bindthis 10017
wplatformelementsplatformelementiddeferredpromisedonefunction var17
however we17
if eventpropertyname17
0 wplatformelementsplatformelementiddeferredobjectresolve17
typeof documentdocumentelementappready17
function we17
elementdefinitionextend initialize17
element elementdefinitionextend17
var element17
platformelementextend var17
elementdefinition platformelementextend17
elementdefinition null17
undefined typeof17
elementdefinition undefined17
function defined17
new element17
element el17
documentdocumentelementappready undefined17
functionevent if17
undefined documentdocumentelementappready17
documentdocumentelementappready 017
0 if17
if documentdocumentelementappready17
documentdocumentelementappready windowineditor17
windowineditor windowineditor17
developer however17
if documentcreateevent17
documentcreateevent documentaddeventlistener17
documentaddeventlistener documentaddeventlistenerappready17
else documentdocumentelementattacheventonpropertychange17
documentdocumentelementattacheventonpropertychange functionevent17
wplatformelementsplatformelementiddeferredobjectresolve wplatformelementsplatformelementiddeferredpromisedonefunction17
thisconstructorsuperinitializeapplythis bindthis17
dependencieslength 017
function w17
wloadedplatformdependencies undefined17
typeof wloadedplatformdependencies17
100 elementprototypesettings17
elementprototypesettings new17
elementprototypeuserid 960167517
var platformelementid17
9601675 elementprototypesiteid17
dependencies null17
var dependencies17
platformelementsettings var17
platformelement platformelementsettings17
backbone platformelement17
w backbone17
utilplatformelementsplatformelementsettings function17
undefined wloadedplatformdependencies17
utilplatformelementsplatformelement utilplatformelementsplatformelementsettings17
backbone utilplatformelementsplatformelement17
jquery backbone17
underscore jquery17
w-global underscore17
requirefunc w-global17
elements requirefunc17
platform elements17
require specific17
global require17
windowrequire relies17
windowplatformelementrequire windowrequire17
requirefunc windowplatformelementrequire17
var requirefunc17
if dependencieslength17
we still17
wloadedplatformdependencies if17
nextscript wloadedplatformdependenciespushnextscript17
wplatformelementsplatformelementiddeferredobjectpromise ifintersectionwloadedplatformdependencies17
ifintersectionwloadedplatformdependencies dependencieslength17
dependencieslength dependencieslength17
dependencieslength reducedependencies17
reducedependencies functionpromise17
functionpromise nextscript17
wloadedplatformdependenciespushnextscript return17
deferred wplatformelementsplatformelementiddeferredpromise17
return promisethenfunction17
promisethenfunction return17
return getscriptnextscript17
getscriptnextscript promisethenfunction17
promisethenfunction wplatformelementsplatformelementiddeferredobjectresolve17
wplatformelementsplatformelementiddeferredobjectresolve if17
wplatformelementsplatformelementiddeferredpromise wplatformelementsplatformelementiddeferredobjectpromise17
new deferred17
wplatformelementsplatformelementiddeferredobject new17
typeof wplatformelementsplatformelementid17
typeof wplatformelements17
undefined wplatformelements17
wplatformelements if17
wplatformelements undefined17
wplatformelementsplatformelementid undefined17
undefined wplatformelementsplatformelementid17
wplatformelementsplatformelementid wplatformelementsplatformelementiddeferredobject17
function if16
box-sizing border-box16
display thatsettingsget16
solid trans15
-moz-box-sizing border-box15
border-box -webkit-box-sizing15
-webkit-box-sizing border-box15
border-box -ms-box-sizing15
-ms-box-sizing border-box15
border-box box-sizing15
margin 014
center element-08b85206-8798-4c6f-a1cf-ea8658e83eca13
platformelementextend initialize13
border-radius 100px13
flex-direction-nav flex-next13
100px -moz-border-radius13
-moz-border-radius 100px13
flex-direction-nav flex-prev13
none element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d60613
100px -webkit-border-radius13
element-08b85206-8798-4c6f-a1cf-ea8658e83eca boofullwidthslider13
flex-control-paging li13
0 013
-webkit-border-radius 100px13
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialsliderstyle-512
flex-prev background12
left 012
element-08b85206-8798-4c6f-a1cf-ea8658e83eca textoverlay-112
textoverlay-1 booslidecontent12
flex-next background12
bootestimonialauthor h412
100px element-08b85206-8798-4c6f-a1cf-ea8658e83eca12
if width12
resizetimeout null12
padding 011
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialslider11
bootestimonialauthor h311
background fff11
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialsliderstyle-611
elementdefinition function10
display inline-block10
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialsliderstyle-110
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialsliderstyle-710
ifthisstartscroll clearintervalthisstartscroll10
none important10
no-repeat element-08b85206-8798-4c6f-a1cf-ea8658e83eca10
534040 important10
top no-repeat9
ih fast9
height ih9
true function9
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialsliderstyle-49
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialsliderstyle-39
booimage img9
height ch1009
ch100 fast9
left top9
important element-08b85206-8798-4c6f-a1cf-ea8658e83eca9
text-align center9
async true9
background trans9
if mobilesettingget8
else mobilesetting8
mobilesetting false8
false mobilesetting8
thissettingsgetmobiletrue var8
mobilesettingget false8
color 5340408
var body8
body if8
marketplaceeditmysitecomuploadsbmarketplace-elements-971000768590423757-101assets new8
0 mobilesettingget8
overflow hidden8
mobilesettingget 08
body body8
element-08b85206-8798-4c6f-a1cf-ea8658e83eca flex-direction-nav8
elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplace-elements-971000768590423757-101assets8
var mobilesetting8
mobilesettingget thissettingsgetmobiletrue8
remove bodyaddclassanimations-included8
center border8
0 10px8
waddons-animation-block visibility8
if bodyhasclassanimations-included8
bodyhasclassanimations-included head8
head linkrelstylesheetfirstbefore8
linkrelstylesheetfirstbefore waddons-animations-sheetnot8
waddons-animations-sheetnot first8
first remove8
bodyaddclassanimations-included jquery8
var mobilesettingget8
platformelementid 971000768590423757-1018
971000768590423757-101 if8
var waddonsanimations8
waddonsanimations platformelementextend8
function thiswaddonsanims8
height 1008
absolute left8
thiswaddonsanims waddonsanims8
waddonsanims function8
mobilesetting var8
mobilesetting true8
solid fff8
httpscdnjscloudflarecomajaxlibswow112wowminjs datatype8
if bodyhasclassanim-added8
url callback8
callback ajax8
undefined loadscripturltosomescriptjs8
someobject undefined8
typeof someobject8
bodyaddclassanim-added if8
true bodyaddclassanim-added8
function new8
ajax url8
callback async8
success callback8
script success8
datatype script8
url httpscdnjscloudflarecomajaxlibswow112wowminjs8
loadscripturltosomescriptjs function8
new wow8
bodyhasclassanim-added loadscript8
wow mobile8
mobile mobilesetting8
mobilesetting init8
loadscript function8
css display8
init return8
display value8
function url8
return waddonsanimations8
waddonsanimations if8
possible type7
absolute width7
platformelement function7
0 position7
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialsliderstyle-27
auto important7
0 important7
type platformelement7
element rendering7
1px solid7
border 0px7
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonial7
0px solid7
imganimate height6
border 3px6
only screen6
10px 06
clearintervalthisstartscroll thisstartscroll6
right 06
20px element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6066
setintervalfunction thisnext6
thisnext thisautoslide10006
media only6
3px solid6
5 16
height 20px6
10px solid6
slides booimage6
thisbootestimonialslidecontentanimate height6
center border-radius6
0 margin6
trans element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6066
content display6
fff border-radius6
elfindflex-viewportanimate height6
thisstartscroll setintervalfunction6
padding-right 30px5
03s ease-in-out5
img width5
opacity 15
booslidecontent paragraph5
0 auto5
booslidecontent h25
100 height5
all 1s5
1s ease5
jquery function5
height 12px5
z-index 15
all 03s5
width 26px5
all 800ms5
-webkit-transform rotate180deg5
20px top5
bootestimonialavatar img5
center element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6065
float left5
800ms cubic-bezier07700000017510005
height 05
var height5
none element-08b85206-8798-4c6f-a1cf-ea8658e83eca5
0 element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6065
-ms-transform rotate180deg5
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 boostarrating5
rotate180deg -webkit-transform5
resize function5
6px element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6065
trans background5
6px -webkit-border-radius5
6px -moz-border-radius5
margin-top 20px5
rotate180deg transform5
transform rotate180deg5
20px position4
relative important4
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606 bootestimonialcontent4
element-08b85206-8798-4c6f-a1cf-ea8658e83eca flex-control-paging4
-moz-transform scale-114
-webkit-border-radius 6px4
img position4
1px content4
border-bottom 1px4
height 1px4
relative border4
all 3s4
-moz-border-radius 6px4
border-radius 6px4
important font-size4
scale-11 -webkit-transform4
font-size 17px4
17px important4
26px height4
0 6px4
fast elfindlieqnextslideanimate4
-webkit-transform scale1-14
scale1-1 element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6064
fast elfindlieqnextslidefindbooimage4
elfindlieqnextslidefindbooimage imganimate4
min-height 100px4
30px padding-right4
padding 20px4
padding-left 30px4
20px 20px4
paragraph padding-left4
h2 element-08b85206-8798-4c6f-a1cf-ea8658e83eca4
top 20px4
else var4
var ww4
transform scale1-14
scale1-1 -o-transform4
visibility visible4
visible function4
clear both4
scale1-1 transform4
content position4
-ms-transform scale1-14
0 right4
scale1-1 -ms-transform4
elfindlieqnextslideanimate height4
bootestimonialcontrols li4
width 16px4
-o-transform scale1-14
100px element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6064
16px height4
element-08b85206-8798-4c6f-a1cf-ea8658e83eca boofullwidthsliderresizedbyheight4
display thatupdate4
md else4
elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplace-elements-874959678356211109-101assets4
hide-box css4
marketplaceeditmysitecomuploadsbmarketplace-elements-874959678356211109-101assets new4
update value4
30px element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6064
lg update4
element-08b85206-8798-4c6f-a1cf-ea8658e83eca flex-control-nav4
thatsettingsget lg4
boofullwidthslider margin4
else display4
thatsettingsget md4
display installresizehandler4
1200 display4
boofullwidthslider slides4
width 12004
element-08b85206-8798-4c6f-a1cf-ea8658e83eca boofullwidthsliderfullheight-14
sm else4
thatsettingsget sm4
992 display4
width 9924
xs else4
thatsettingsget xs4
768 display4
display display4
hidebox if4
use if4
66 66ms4
actualresizehandler execution4
queue if4
if resizetimeout4
null resizetimeout4
resizetimeout settimeout4
settimeout function4
function resizetimeout4
ignore resize4
null thatactualresizehandler4
thatactualresizehandler 664
function ignore4
15fps actualresizehandler4
return hidebox4
actualresizehandler function4
function thatupdate4
thatupdate initialize4
elements display4
window resize4
thatupdate need4
window resizes4
function window4
installresizehandler function4
resizes thatinstallresizehandler4
thatinstallresizehandler return4
resize events4
width 7684
which display4
arrowstyle-5 flex-direction-nav4
-o-transition all4
transition all4
var hidebox4
874959678356211109-101 if4
platformelementid 874959678356211109-1014
concept creatie4
border-box function4
hide-box-content -moz-box-sizing4
hide-box hide-box-content4
null hidebox4
hide-box -moz-box-sizing4
element-08b85206-8798-4c6f-a1cf-ea8658e83eca arrowstyle-54
border-box -moz-box-sizing4
hidden function4
visibility hidden4
element-08b85206-8798-4c6f-a1cf-ea8658e83eca arrowstyle-34
arrowstyle-3 flex-direction-nav4
1 background4
urlmarketplaceeditmysitecomuploadsbmarketplace-elements-294973650257440885-116assetsarrow-style-3-nextpng no-repeat4
hidebox resizetimeout4
-moz-transition all4
hidebox platformelementextend4
determine which4
width determine4
max-width none4
window width4
width window4
width width4
screen width4
get screen4
width get4
100 important4
zoom 14
use width4
var display4
focus concept4
boofullwidthsliderresizedbyheight slides4
update function4
-webkit-transition all4
platformelementextend update4
urlmarketplaceeditmysitecomuploadsbmarketplace-elements-294973650257440885-116assetsarrow-style-3-prevpng no-repeat4
6px 6px3
gonneke berendsen3
ex btw3
0 30px3
var elementheights3
womanwise 13
ifthisequalheight var3
li clickscroll3
incl 13
heb je3
voor je3
rocket stove3
stove store3
hermine schoneveld3
schoneveld eigenaar3
eigenaar womanwise3
elementheights thisbootestimonialslidecontent3
padding-top 20px3
thisbootestimonialslidecontent bootestimonialmapfunction3
re-sliding settimeoutfunction3
clearintervalthisstartscroll consolelogstop3
border-top-right-radius 40px3
40px border-top-right-radius3
-moz-border-top-right-radius 40px3
consolelogstop thisstartscroll3
40px -moz-border-top-right-radius3
thisstartscroll function3
function hold3
-webkit-border-top-right-radius 40px3
50 auto3
40px -webkit-border-top-right-radius3
border-top-left-radius 40px3
auto start3
start time3
40px border-top-left-radius3
stop thisbootestimonialsliderhoverfunction3
20px padding-bottom3
100 -moz-box-sizing3
left width3
both float3
colored-box-content clear3
current thisbulletfilteractivedataslide3
var current3
padding-bottom 20px3
-moz-border-top-left-radius 40px3
20px padding-left3
30px -webkit-border-top-left-radius3
thisautoslide1000 mathroundthisautoslide210003
-webkit-border-top-left-radius 40px3
40px -moz-border-top-left-radius3
settimeoutfunction ifthisstartscroll3
thisbootestimonialsliderhoverfunction ifthisstartscroll3
40px -webkit-border-bottom-left-radius3
bootestimonialmapfunction return3
elementheights thisbootestimonialslidecontentanimate3
height height253
return coloredbox3
maxheight25 else3
height maxheight253
elementprototypeassetspath marketplaceeditmysitecomuploadsbmarketplace-elements-848857247979793891-101assets3
marketplaceeditmysitecomuploadsbmarketplace-elements-848857247979793891-101assets new3
mathmaxapplynull elementheights3
coloredbox platformelementextend3
maxheight mathmaxapplynull3
border-box background-color3
var maxheight3
get var3
thisouterheight get3
return thisouterheight3
function return3
var coloredbox3
-webkit-border-bottom-left-radius 40px3
40px -webkit-border-bottom-right-radius3
40px -moz-border-bottom-left-radius3
-moz-border-bottom-left-radius 40px3
ifthisstoponhover hover3
thisautoslide1000 ifthisstoponhover3
40px border-bottom-left-radius3
border-bottom-left-radius 40px3
-webkit-border-bottom-right-radius 40px3
848857247979793891-101 if3
40px -moz-border-bottom-right-radius3
-moz-border-bottom-right-radius 40px3
40px border-bottom-right-radius3
border-bottom-right-radius 40px3
40px step3
platformelementid 848857247979793891-1013
coloredbox if3
home focus3
bootestimonialsliderstyle-6 bootestimonialauthor3
arrowsize-medium flex-direction-nav3
1 element-08b85206-8798-4c6f-a1cf-ea8658e83eca3
element-08b85206-8798-4c6f-a1cf-ea8658e83eca flex-viewport3
-ms-transition all3
flex-viewport min-height3
100 z-index3
text-indent -9999px3
cursor pointer3
element-08b85206-8798-4c6f-a1cf-ea8658e83eca arrowsize-large3
arrowsize-large flex-direction-nav3
element-08b85206-8798-4c6f-a1cf-ea8658e83eca arrowsize-medium3
element-08b85206-8798-4c6f-a1cf-ea8658e83eca arrowsize-small3
important height3
arrowsize-small flex-direction-nav3
border-radius 10px3
10px -moz-border-radius3
-moz-border-radius 10px3
10px -webkit-border-radius3
-webkit-border-radius 10px3
10px element-08b85206-8798-4c6f-a1cf-ea8658e83eca3
10px 10px3
absolute bottom3
12px background3
height auto3
element-08b85206-8798-4c6f-a1cf-ea8658e83eca booimage3
height 16px3
boofullwidthslidershowloading-1 min-height3
creatie portfolio3
portfolio tips3
new platformelementsettingsxsnonesmnonemdblocklgblock3
platformelementsettingsxsnonesmnonemdblocklgblock elementprototypesettingspageelementid3
ahover element-08b85206-8798-4c6f-a1cf-ea8658e83eca3
slides li3
margin 0px3
0px 03
20px important3
element-08b85206-8798-4c6f-a1cf-ea8658e83eca boofullwidthslidershowloading-13
li display3
user-select none3
boofullwidthsliderfullheight-1 slides3
min-height 100vh3
-webkit-user-select none3
none -khtml-user-select3
-khtml-user-select none3
none -moz-user-select3
-moz-user-select none3
none -o-user-select3
-o-user-select none3
none user-select3
height 14px3
16px background3
rotate180deg -moz-transform3
block position3
inline-block element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
width 03
100 element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
h3 paragraph3
paragraph element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
h4 paragraph3
f8a9a9 important3
block element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
trans border-radius3
left 20px3
bootestimonialauthor display3
bootestimonialcontent text-align3
bootestimonialauthorboohidden display3
margin-top 10px3
relative text-align3
bootestimonialavatarafter border-bottom3
trans height3
top 48px3
48px element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
important z-index3
bootestimonialcontrols position3
important bottom3
text-align right3
bootestimonialavatar display3
relative element-08b85206-8798-4c6f-a1cf-ea8658e83eca3
else elremoveclassresizedbyheight3
vertical-align middle3
0 top3
top 03
5px 03
min-height 200px3
background-size 1003
100 auto3
ih eladdclassresizedbyheight3
eladdclassresizedbyheight elfindflex-viewportanimate3
fast else3
elremoveclassresizedbyheight elfindflex-viewportanimate3
ahover color3
var nextslide3
0 var3
elfindflex-active-slide booimage3
wat je3
wat ik3
hidden element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
1 element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
relative overflow3
left element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d6063
bootestimonialslider bootestimonialcontrols3
var s3
if225
var217
0182
function175
element-44d82a7b-0c6c-40a9-95fc-b4faa9d2d606136
element-08b85206-8798-4c6f-a1cf-ea8658e83eca118
typeof110
display93
undefined93
width90
height80
elementdefinition68
important66
else66
border-box65
center64
new61
return60
background57
none55
154
dependencieslength51
initialize51
documentdocumentelementappready51
position51
null47
100px46
element45
flex-direction-nav45
20px44
40px41
we40
240
left39
false39
no-repeat38
bootestimonialauthor35
wplatformelementsplatformelementiddeferredobjectresolve34
platformelementextend34
wplatformelementsplatformelementid34
wplatformelements34
wloadedplatformdependencies34
requirefunc34
backbone34
windowineditor34
want34
call34
placeholders34
promisethenfunction34
10px33
mobilesetting32
li31
je29
relative28
jquery28
solid27
326
transparent26
use25
trans25
margin25
425
true25
524
platformelement24
top24
624
mobilesettingget24
setintervalfunction23
absolute23
padding23
-moz-border-radius22
border-radius22
-webkit-border-radius22
elements21
resizetimeout20
content20
30px20
6px20
van19
ik19
all19
bootestimonialslider19
fff19
fast18
718
block18
818
een18
el18
border18
platform18
auto18
thisconstructorsuperinitializeapplythis17
elementprototypesettings17
elementprototypesettingspageelementid17
clearintervalthisplaceholderinterval17
thisplatform-element-child-placeholderlength17
elementprototypeelementid17
bindthis17
functionevent17
elementprototypeuserid17
elementprototypesiteid17
img17
elementprototypeassetspath17
documentaddeventlistener17
documentaddeventlistenerappready17
documentdocumentelementattacheventonpropertychange17
eventpropertyname17
appready17
box-sizing17
check17
documentcreateevent17
setinterval17
wplatformelementsplatformelementiddeferredobjectpromise17
w17
platformelementsettings17
dependencies17
platformelementid17
wplatformelementsplatformelementiddeferredobject17
deferred17
wplatformelementsplatformelementiddeferredpromise17
ifintersectionwloadedplatformdependencies17
underscore17
reducedependencies17
functionpromise17
nextscript17
wloadedplatformdependenciespushnextscript17
so17
getscriptnextscript17
wplatformelementsplatformelementiddeferredpromisedonefunction17
utilplatformelementsplatformelementsettings17
utilplatformelementsplatformelement17
w-global17
specific17
thisplaceholderinterval17
replaced17
been17
have17
until17
dont17
however17
developer17
defined17
still17
elementdefinitionextend17
windowplatformelementrequire17
windowrequire17
relies17
global17
require17
boofullwidthslider16
bootestimonialavatar16
right16
eigenaar16
ih16
thatsettingsget16
waddonsanimations16
scale1-116
body16
-webkit-box-sizing16
-moz-box-sizing16
url16
callback16
-ms-box-sizing15
voor15
rotate180deg15
booimage14
text-align14
hidden14
booslidecontent14
met14
het14
value13
bootestimonial13
1px13
flex-prev13
flex-control-paging13
slides13
paragraph13
flex-next13
window13
z-index13
resize13
h412
update12
wat12
0px12
hidebox12
textoverlay-112
min-height12
bootestimonialcontrols12
bootestimonialsliderstyle-512
actualresizehandler12
color12
hide-box12
te11
bootestimonialcontent11
amp11
bootestimonialsliderstyle-611
h311
910
cursor10
cubic-bezier077000000175100010
inline-block10
bootestimonialsliderstyle-110
screen10
-webkit-transform10
ifthisstartscroll10
clearintervalthisstartscroll10
overflow10
bootestimonialsliderstyle-710
thisstartscroll10
max-width10
bootestimonialsliderstyle-49
async9
bootestimonialsliderstyle-39
opacity9
ch1009
transform9
-ms-transform9
bottom9
init9
head8
linkrelstylesheetfirstbefore8
bodyhasclassanimations-included8
first8
waddons-animations-sheetnot8
ahover8
visibility8
waddons-animation-block8
type8
tekst8
thissettingsgetmobiletrue8
16px8
thiswaddonsanims8
css8
remove8
float8
bodyaddclassanimations-included8
padding-right8
op8
loadscript8
boostarrating8
thatupdate8
margin-top8
971000768590423757-1018
ajax8
httpscdnjscloudflarecomajaxlibswow112wowminjs8
datatype8
script8
success8
bodyaddclassanim-added8
someobject8
loadscripturltosomescriptjs8
bodyhasclassanim-added8
wow8
marketplaceeditmysitecomuploadsbmarketplace-elements-971000768590423757-101assets8
mobile8
waddonsanims8
3px7
focus7
12px7
media7
rendering7
padding-left7
bootestimonialsliderstyle-27
website7
s7
get7
possible7
mijn7
required7
beeld6
thisautoslide10006
50px6
thisnext6
thisbootestimonialslidecontentanimate6
coloredbox6
elementheights6
elfindflex-viewportanimate6
only6
25px6
ww6
events6
samen6
visible6
bsresize6
imganimate6
tekstenfee6
marjolein6
font-size6
bootestimonialavatarimage6
tmpheight6
800ms5
elfindlieqnextslidefindbooimage5
mij5
bootestimonialavatarafter5
als5
heeft5
dat5
26px5
zijn5
heb5
jouw5
touchstart5
105
flex-viewport5
115
ease5
-o-transition5
die5
14px5
03s5
70px5
-moz-transition5
-webkit-transition5
1s5
ease-in-out5
h25
15px5
concept5
transition5
thatinstallresizehandler4
padding-bottom4
border-bottom4
touchmove4
element-7816d8dd-2951-4b2d-be1c-1546198c45944
3s4
marketplaceeditmysitecomuploadsbmarketplace-elements-874959678356211109-101assets4
hide-box-content4
setupelement7830813245262238274
flex-control-nav4
talent4
boofullwidthsliderfullheight-14
wanalytics4
124
-moz-user-select4
overleg4
border-color4
zoom4
boofullwidthsliderresizedbyheight4
setupelement9921969686369512184
both4
17px4
setupelement4588869365379473404
resizes4
874959678356211109-1014
jou4
134
144
sm4
154
md4
lg4
installresizehandler4
which4
determine4
naar4
ignore4
long4
setupelement4238081241162219574
bootestimonialcontentwrap4
execution4
queue4
settimeout4
thatactualresizehandler4
164
66ms4
-o-transform4
execute4
scale-114
-moz-transform4
rate4
15fps4
need4
clear4
xs4
setupelement8721931933737223824
iftypeof4
element-ae54737e-18d4-4254-b458-29fe023b3eff4
setupelement3579914633288567214
setupelement6550848356956069534
setupelement4804854965833335354
elfindflex-active-slide4
creatie4
ch4
32px4
thisheight4
irh4
irw4
nextslide4
arrowstyle-34
incl4
urlmarketplaceeditmysitecomuploadsbmarketplace-elements-294973650257440885-116assetsarrow-style-3-prevpng4
urlmarketplaceeditmysitecomuploadsbmarketplace-elements-294973650257440885-116assetsarrow-style-3-nextpng4
elfindlieqnextslideanimate4
arrowstyle-54
clickscroll4
booslidecaption4
touchend4
setupelement3673817877459351684
setupelement7198306882639154644
setupelement8867337196447689944
setupelement4804600188513992674
ontwerp4
nbsp4
setupelement7615472434276913844
logo4
text-indent4
hanna4
setupelement1853802428694059414
deze4
-ms-transition4
5px4
setupelement6821829109742294864
element-10ed8a63-267b-4088-ada1-3b67f393f5d24
zichtbaar4
8203ik4
element-24653960-d570-4031-bda3-c9bd4ca9414c4
ex4
setupelement7303883865627243334
kan4
background-size4
setupelement7937473337721778564
bootestimonialmapfunction3
thisbootestimonialsliderhoverfunction3
mathmaxapplynull3
stop3
wanalyticsspcontexts3
discoverrootdomain3
height253
maxheight253
thisbootestimonialslidecontent3
thisouterheight3
ifthisequalheight3
ifthisstoponhover3
173
hover3
maxheight3
track3
marketplaceeditmysitecomuploadsbmarketplace-elements-848857247979793891-101assets3
consolelogstop3
-webkit-border-top-right-radius3
848857247979793891-1013
step3
border-bottom-right-radius3
-moz-border-bottom-right-radius3
prijs3
-webkit-border-bottom-right-radius3
btw3
ontwerpen3
border-bottom-left-radius3
-moz-border-bottom-left-radius3
-webkit-border-bottom-left-radius3
border-top-right-radius3
-moz-border-top-right-radius3
slide3
hold3
border-top-left-radius3
-moz-border-top-left-radius3
183
-webkit-border-top-left-radius3
padding-top3
background-color3
colored-box-content3
thisbulletfilteractivedataslide3
current3
mathroundthisautoslide210003
settimeoutfunction3
re-sliding3
time3
start3
gaq3
home3
functione3
background-position3
ziel3
al3
wereld3
doe3
vorm3
windowwidth3
elremoveclassresizedbyheight3
eladdclassresizedbyheight3
thisww3
24px3
200px3
60px3
middle3
vertical-align3
arrowsize-small3
maken3
100vh3
portfolio3
tips3
tricks3
deel3
platformelementsettingsxsnonesmnonemdblocklgblock3
boofullwidthslidershowloading-13
-webkit-user-select3
arrowsize-medium3
-khtml-user-select3
-o-user-select3
user-select3
-9999px3
pointer3
arrowsize-large3
wenst3
a82e2e3
thisclicked3
womanwise3
rocket3
stove3
store3
mooie3
hermine3
schoneveld3
site3
essentie3
om3
gesprek3
dit3
iets3
thisstartx3
thisstarty3
samenwerking3
veel3
ff5b4f3
bootestimonialauthorboohidden3
bootestimonialavatarimg3
aafter3
ahoverafter3
f8a9a93
border-top3
193
bootestimonialquotebefore3
heel3
bootestimonialavatarboohidden3
48px3
content-box3
margin-bottom3
gonneke3
berendsen3
appid3

Who hosts Visueel.online?

Visueel.online Hosting Provider Information

Hosted IP Address:91.184.0.62
Hosted Hostname:91-184-0-62.forward.hostnet.nl
Service Provider:Hostnet B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.3824
Location Longitude:4.8995
Webserver Software:Apache

Is "Hostnet B.V." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
Hostnet B.V.
0.1286%

HTTP Header Analysis for Visueel.online

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 23 Dec 2020 18:58:25 GMT
Server: Apache
Vary: X-W-SSL,Accept-Encoding,User-Agent
Cache-Control: private
ETag: W/"a0c649cafd66ae15e3eb84ce11df48c9-gzip"
Content-Encoding: gzip
X-Host: pages25.sf2p.intern.weebly.net
X-UA-Compatible: IE=edge,chrome=1
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Visueel.online Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Visueel.online?


Domain Registration (WhoIs) information for Visueel.online

Websites with Similar Names

Visue.dk
Forside > Nordic Custom Made
Visuecstock.com
Visuec Stock
Visueel-adv.be
Reclamebureau Visueel Advertising | Agency | Kortrijk, West-Vlaanderen
Visueel.online
Tekstenfee
Visueelcollectief.com
Hostnet, domeinnaamregistratie, webhosting, dedicated hosting, VPS
Visueelleiden.com
Dit domein is geregistreerd door een klant van Oxilion.
Visuel-concept.com
Agence de Communication - VISUEL CONCEPT Agence de Communication le Havre Montivilliers
Visuel-concept.fr
Agence de Communication - VISUEL CONCEPT Agence de Communication le Havre Montivilliers
Visuel-concept.net
agence d’étude et de conception lumière à Biarritz et Bayonne

Recently Updated Websites

Repetal.com (2 seconds ago.)Oggpornlist.com (4 seconds ago.)Trayectodigital.com (5 seconds ago.)Hapoc.info (5 seconds ago.)Boardstrike.ru (5 seconds ago.)Bez-secretov.com (5 seconds ago.)Birthtokarma.com (6 seconds ago.)Elesztohaz.hu (7 seconds ago.)Dotjewels.gr (8 seconds ago.)Ut103.com (8 seconds ago.)Yule6103.com (8 seconds ago.)Beautyparfumcadeau.nl (8 seconds ago.)Theladypi.com (8 seconds ago.)Tqooncafe.com (9 seconds ago.)Happylysm.com (9 seconds ago.)Kinderglueck-der-familienblog.de (9 seconds ago.)Sirendc.com (9 seconds ago.)Sswap.com (10 seconds ago.)Sundayxx.shop (10 seconds ago.)Eastcliffbeachresort.com (11 seconds ago.)Biocleandisinfection.com (11 seconds ago.)Ruye.site (11 seconds ago.)Onlyhoa.com (11 seconds ago.)Xxx001.xyz (11 seconds ago.)Myfarmparts.com (11 seconds ago.)Aplanformymoney.com (12 seconds ago.)Zimmergroup.us (12 seconds ago.)Africanmango.com (12 seconds ago.)Nhga.net (12 seconds ago.)Flameproof.equipment (13 seconds ago.)

Recently Searched Keywords

woda gazy obojtne (1 second ago.)0 rgba304161010 (2 seconds ago.)candida_romaguera9 (4 seconds ago.)aes-256 aes-256 (5 seconds ago.)самая быстрая видеокарта geforce rtx 3090 появилась в российском магазине – все доступные экземпляры куплены за считанные часы (6 seconds ago.)cc loi my (7 seconds ago.)zdobądź oznakę! (8 seconds ago.)local guide (8 seconds ago.)cat grooming (9 seconds ago.)sistemi kanamalarsindirim (10 seconds ago.)thaikkudam bridge members (10 seconds ago.)hydraulic air compressors (11 seconds ago.)opacity 015s linear (11 seconds ago.)stuart coleman charleston sc (13 seconds ago.)mane (13 seconds ago.)parish hall meaning in hindi (15 seconds ago.)сонник (15 seconds ago.)hotelzimmer (18 seconds ago.)пуфы от 1500 руб (19 seconds ago.)ramin bayramlı ailəsi (20 seconds ago.)normal font-variant normal (21 seconds ago.)23 minutes 58 (21 seconds ago.)australia hotel fremantle | excellent value, great location! (24 seconds ago.)08-19.撮影ヤル気全然ない系ビッチのニコたんは超有名配信者なのにsnsアカでセフレ募集中ってマジ?マジです (24 seconds ago.)macbeth quiz (25 seconds ago.)chad chile (25 seconds ago.)digər (27 seconds ago.)welcombaraftersubmission (27 seconds ago.)gear news (28 seconds ago.)65 65comp-jztyv63b (29 seconds ago.)