Visitors to Museums & Galleries in America - Guides, Coupons and Museum Tips

Safety: Low trust score
Year Founded: 2012
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Guides, Coupons and Museum Tips



Domain summary

Last updated
2020-11-07
Domain label
vmga
Domain extension
org
Domain registered:
2012-05-11
Domain updated:
2020-11-07
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is vmga.org ranked relative to other sites:

Percentage of visits to vmga.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Vmga.org registered?
A: Vmga.org was registered 8 years, 11 months, 1 week, 1 day, 15 hours, 23 minutes, 22 seconds ago on Friday, May 11, 2012.
Q: When was the WHOIS for Vmga.org last updated?
A: The WHOIS entry was last updated 5 months, 1 week, 5 days, 15 hours, 23 minutes, 22 seconds ago on Saturday, November 7, 2020.
Q: What are Vmga.org's nameservers?
A: DNS for Vmga.org is provided by the following nameservers:
  • ns1.virtono.com
  • ns2.virtono.com
  • ns3.virtono.com
  • ns4.virtono.com
Q: Who is the registrar for the Vmga.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Vmga.org?
A: Vmga.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Vmga.org each day?
A: Vmga.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Vmga.org resolve to?
A: Vmga.org resolves to the IPv4 address 104.37.174.139.
Q: In what country are Vmga.org servers located in?
A: Vmga.org has servers located in the United States.
Q: What webserver software does Vmga.org use?
A: Vmga.org is powered by Apache webserver.
Q: Who hosts Vmga.org?
A: Vmga.org is hosted by Host NIT Inc in Texas, Carrollton, United States, 75006.
Q: How much is Vmga.org worth?
A: Vmga.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Vmga.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Vmga.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Vmga.org

H1 Headings

1 :
  1. Visitors to Museums & Galleries in America

H2 Headings

12 :
  1. Use A Library Card + Expedia Coupons to Explore Massachusetts Galleries & Museums
  2. Expedia Promo Codes Make Weekend Getaways Affordable.
  3. Have Library Card, Will Travel
  4. 5 Beautiful American Museums Outside of New York
  5. Shrewsbury Historical Society, Incorporated Museum
  6. Bennington Battle Monument
  7. Bread and Puppet Museum
  8. Shelburne Farms
  9. Check out Shelburne Farms in Vermont.
  10. Black River Academy Museum and Historical Society
  11. Detroit Art Galleries: An Exploration
  12. Art Galleries of Detroit

H3 Headings

4 :
  1. There’s Amazing Museums Outside of NYC.
  2. Walker Art Center, Minneapolis, Minnesota
  3. de Young Museum, San Francisco, California
  4. You Can Stay Overnight Here.

H4 Headings

5 :
  1. What's Popular:
  2. Recent Entires:
  3. Categories
  4. Visitors to Museums & Galleries in America
  5. Tags

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

22 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

83:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

1:

Keyword Cloud for Vmga.org

coolidgemuseums ampacademyunderart centeramp3shrewsbury historicalpuppetkexplore massachusetts galleriesyoungattractionsexplore massachusettsvisitorshighamerican museumsbeautiful american museumsmuseum and historicalif wppimageslengthwalkerhellip readfarmshousewppimageslengthbenningtonlibrary cardart galleriesevenreading rarrwppwidgetimagesyoung museumchildrenscontinue reading rarrreadingvartypehotelwar museumsmuseums amp galleriesread the restart museumhistoricpuppet museumyouoldmuseums filedblack riveramerican1expedia couponsmonumentdetroit artmailingwalker artvmgaovernewpublic libraryhourstourshistory0societyroutecivilrivershelburnegalleries of detroitvisitors to museumsbennington battle monumentjulycouponsnaturegallerieshistorical museumcard expediareadbeautiful americanexpediachildrens museummichigansuchvermontletacademy museumvt mailingrestincorporated museumrest continue readingexplorecenterhigh schoolweekendjamerican museums outsidepublicshrewsbury historical societycenturyif wppwidgetimageslengthhistorical society incorporatedcontinue readinguspostedoutside of newsociety incorporatedblackrarr postedcontactincorporatedoutsiderest continueifbattle monumentlibrary card expediaagricultural museumdetroit art galleriescontinuebuildingwebbcultureamp galleriescalvinsociety incorporated museumcoupons to exploreriver academy museumwppwidgetimageslengthareamuseums outsidemuseums filed underhellipmuseumwppwidgetsfiledwppwidgetslengthcalvin coolidgebennington battlethroughlikewhichschoolhousemassachusettsdayartmajorhistorical societyshelburne farmslibrarywalker art centerludlowshrewsburycardalsohomefiled underbreadmassachusetts galleriesmuseumsorchestrablack river academyfunctionriver academy2historicalfunction wppobserveimgscanwarrarrtravelotherinnagriculturalvtdetroitincludedesignedbattleyou canadmissioncard expedia couponslendsbeautifulreading rarr postedrenownedpassescivil war museumsdetroit detroitmembersschoolbread and puppetexhibitwppobserveimgscivil war

Longtail Keyword Density for Vmga.org

KeywordsOccurences
read the rest8
rest continue reading8
continue reading rarr8
reading rarr posted8
historical society incorporated4
river academy museum4
museums filed under4
bread and puppet4
civil war museums4
walker art center4
shrewsbury historical society4
visitors to museums3
detroit art galleries3
museum and historical3
black river academy3
bennington battle monument3
outside of new3
society incorporated museum3
museums amp galleries3
american museums outside3
beautiful american museums3
explore massachusetts galleries3
coupons to explore3
card expedia coupons3
library card expedia3
galleries of detroit3
art galleries13
continue reading8
rarr posted8
reading rarr8
rest continue8
civil war7
filed under7
historical society7
detroit art6
hellip read6
academy museum5
if wppwidgetimageslength4
shrewsbury historical4
society incorporated4
art center4
war museums4
shelburne farms4
black river4
river academy4
young museum4
art museum4
walker art4
american museums4
museums filed4
library card4
museums outside4
historical museum3
if wppimageslength3
function wppobserveimgs3
detroit detroit3
high school3
calvin coolidge3
card expedia3
expedia coupons3
explore massachusetts3
agricultural museum3
you can3
massachusetts galleries3
puppet museum3
vt mailing3
battle monument3
bennington battle3
public library3
incorporated museum3
childrens museum3
beautiful american3
amp galleries3
museums amp3
museum44
art29
museums24
galleries21
detroit17
if17
massachusetts14
historical12
library11
you10
coupons9
society9
war9
vmga9
posted8
reading8
farms8
continue8
vt8
vermont8
rest8
read8
rarr8
academy7
under7
let7
filed7
also7
shrewsbury7
monument7
civil7
new6
hellip6
battle6
contact6
public6
shelburne6
function6
agricultural6
expedia6
wppwidgetslength6
ludlow6
river6
through6
bennington6
can5
school5
high5
05
puppet5
bread5
beautiful5
american5
card5
var5
hours5
wppwidgetimageslength5
visitors4
july4
type4
historic4
tours4
wppimageslength4
wppwidgetimages4
black4
young4
mailing4
center4
attractions4
travel4
childrens4
such4
outside4
over4
which4
members4
walker4
even4
amp4
house4
incorporated4
explore4
weekend3
j3
coolidge3
13
exhibit3
like3
culture3
nature3
home3
michigan3
area3
wppobserveimgs3
us3
wppwidgets3
calvin3
inn3
passes3
old3
route3
23
century3
history3
building3
include3
renowned3
major3
33
other3
hotel3
admission3
webb3
designed3
lends3
schoolhouse3
day3
orchestra3
k3

Who hosts Vmga.org?

Vmga.org Hosting Provider Information

Hosted IP Address:104.37.174.139
Hosted Hostname:dallas1.virtono.com
Service Provider:Host NIT Inc
Hosted Country:United StatesUS
Location Latitude:32.9657
Location Longitude:-96.8825
Webserver Software:Apache

Is "Host NIT Inc" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Host NIT Inc
0.0035%

HTTP Header Analysis for Vmga.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 07 Nov 2020 14:51:05 GMT
Server: Apache
Link:; rel="https://api.w.org/"
Content-Encoding: gzip
Vary: Accept-Encoding
Upgrade: h2,h2c
Connection: Upgrade
Content-Length: 16193
Content-Type: text/html; charset=UTF-8

Vmga.org Domain Nameserver Information

HostIP AddressCountry
ns1.virtono.com 45.15.23.99
ns2.virtono.com 89.33.192.99
ns3.virtono.com 45.148.11.99
ns4.virtono.com 45.138.99.99


Need to find out who hosts Vmga.org?


Domain Registration (WhoIs) information for Vmga.org

 Domain Name: VMGA.ORG
Registry Domain ID: D167037460-LROR
Registrar WHOIS Server: whois.discount-domain.com
Registrar URL: www.onamae.com
Updated Date: 2019-11-26T17:04:01Z
Creation Date: 2012-11-05T14:30:15Z
Registry Expiry Date: 2020-11-05T14:30:15Z
Registrar Registration Expiration Date:
Registrar: GMO Internet, Inc. d/b/a Onamae.com
Registrar IANA ID: 49
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +81.337709199
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: Matthew Simpson
Registrant State/Province: British Columbia
Registrant Country: CA
Name Server: NS1.VIRTONO.COM
Name Server: NS2.VIRTONO.COM
Name Server: NS3.VIRTONO.COM
Name Server: NS4.VIRTONO.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-07T11:15:14Z

Websites with Similar Names

Vmga.net
Home: Virginia Master Gardener Association
Vmga.org
Visitors to Museums & Galleries in America - Guides, Coupons and Museum Tips
Vmgadvertising.com
VMG Advertising |
Vmgaffiliate.com
vmgaffiliate.com - Registered at Namecheap.com
Vmgaffiliates.com
vmgaffiliates.com - Registered at Namecheap.com
Vmgaires.com.br
VMG | Aires - Climatização para Ônibus
Vmgallery.kr
vmgallery
Vmgamer.net
easyDNS Parked Page for: vmgamer.net
Vmgames.com
VMgames.com puzzle games for Android and Windows

Recently Updated Websites

2sweethome.com (1 second ago.)Antoninarausch.com (1 second ago.)Backpocketadmin.com (1 second ago.)Compassionatecup.com (2 seconds ago.)Globalip.law (2 seconds ago.)Creditmoneymachinecloud.com (2 seconds ago.)Unplugfromthepatriarchy.com (2 seconds ago.)A5j7ini1.club (3 seconds ago.)Softyline.com (3 seconds ago.)Alariccampbell.net (3 seconds ago.)Reusedrepurposed.com (4 seconds ago.)Myusprinters.us (4 seconds ago.)Aussiemailman.com.au (4 seconds ago.)Amayacassino.com (4 seconds ago.)Sweetartcakedesigns.com (4 seconds ago.)Bnb-n-va.com (4 seconds ago.)Waluna.top (5 seconds ago.)Grandezproducts.com (5 seconds ago.)Allthingsvintageoakland.com (5 seconds ago.)Sanitaryvalvefittings.com (5 seconds ago.)Shynelawgroup.com (6 seconds ago.)Artdecoindia.com (6 seconds ago.)Elufa6.com (6 seconds ago.)Skylineservicesinc.net (6 seconds ago.)Videopark.com.cn (7 seconds ago.)Hongkoin.org (7 seconds ago.)Yoisthisageist.com (7 seconds ago.)Eclipselove.com.br (7 seconds ago.)Natureshealingmassage.com (8 seconds ago.)Billards-baby-foot.ch (8 seconds ago.)

Recently Searched Keywords

末页 (1 second ago.)valhalla reverb (3 seconds ago.)30 geburtstag mann ideen  (3 seconds ago.)jose office (7 seconds ago.)-moz-transform perspective136px (17 seconds ago.)hjem (20 seconds ago.)position relative transform (25 seconds ago.)acitrom 2mg (26 seconds ago.)devon horse (27 seconds ago.)videospiele (29 seconds ago.)interruptores wifi (31 seconds ago.)ogłoszenie dot. przerw w dostawie energii elektrycznej. (34 seconds ago.)golf tuning (34 seconds ago.)tim holtz (36 seconds ago.)ini saya (43 seconds ago.)sus datos seguros (52 seconds ago.)để chế biến một món hủ tiếu giò heo ngon cần sẵn sàng những gì (58 seconds ago.)---------------------------------------------------- (58 seconds ago.)exclusively (1 minute ago.)110 29 40 (1 minute 4 seconds ago.)bbs 10 (1 minute 10 seconds ago.)fedai öztimur (1 minute 13 seconds ago.)escuela (1 minute 13 seconds ago.)trainingsplaene (1 minute 17 seconds ago.)the every mom’s meal solution handbook – print (1 minute 26 seconds ago.)storitve z gradbeno mehanizacijo (1 minute 37 seconds ago.)tyler (1 minute 40 seconds ago.)weight loss (1 minute 42 seconds ago.)электрическая плиткаmt-4210 super slim (1 minute 45 seconds ago.)jose office (1 minute 48 seconds ago.)