Volleyball-bundesliga.de  |  VOLLEYBALL BUNDESLIGA
Low trust score  | 



Volleyball-bundesliga.de Website Information

Website Ranks & Scores for Volleyball-bundesliga.de

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:302,997
Majestic Rank Majestic Rank:681,295
Domain Authority Domain Authority:56%
DMOZ DMOZ Listing:Yes

Whois information for volleyball-bundesliga.de

Full Whois Lookup for Volleyball-bundesliga.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Volleyball-bundesliga.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: volleyball-bundesliga.de
Nserver: nsa3.schlundtech.de
Nserver: nsb3.schlundtech.de
Nserver: nsc3.schlundtech.de
Nserver: nsd3.schlundtech.de
Status: connect
Changed: 2016-09-07T13:47:26+02:00

[Tech-C]
Type: PERSON
Name: Robert Becker
Organisation: Robert Becker IT
Address: Rheinstr. 54
PostalCode: 56564
City: Neuwied
CountryCode: DE
Phone: +49-2631-8312232-0
Fax: +49-2631-8312232-9
Email: Login to show email
2013-07-14T14:39:31+02:00

[Zone-C]
Type: PERSON
Name: Robert Becker
Organisation: Robert Becker IT
Address: Rheinstr. 54
PostalCode: 56564
City: Neuwied
CountryCode: DE
Phone: +49-2631-8312232-0
Fax: +49-2631-8312232-9
Email: Login to show email
2013-07-14T14:39:31+02:00

Who hosts Volleyball-bundesliga.de?

Volleyball-bundesliga.de is hosted by PlusServer AG in Nordrhein-westfalen, Hurth, Germany, 50354.
Volleyball-bundesliga.de has an IP Address of 85.25.133.31 and a hostname of alpha988.startdedicated.de and runs Apache-Coyote/1.1 web server.



Volleyball-bundesliga.de Web Server Information

Hosted IP Address:85.25.133.31
Hosted Hostname:alpha988.startdedicated.de
Service Provider:PlusServer AG
Hosted Country:GermanyDE
Location Latitude:50.8708
Location Longitude:6.86761
Webserver Software:Apache-Coyote/1.1

HTTP Header Analysis for Volleyball-bundesliga.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 29 May 2015 03:25:01 GMT
Server: Apache-Coyote/1.1
Content-Type: text/html;charset=UTF-8
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 15408


Need to find out who hosts Volleyball-bundesliga.de?

Volleyball-bundesliga.de Free SEO Report

Website Inpage Analysis for Volleyball-bundesliga.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Volleyball-bundesliga.de

samstaganimationdelay12der tuiarenavisibilityhidden1300 uhr frauenhidden opacity 0pusicwirdasseptemberpokalsiegergro223raumverkehr hannoverm228nner berlin recyclingteams am sonntag9scores amp statsmit seinersportdeutschlandtvpaar interessanteauchspieler mannschaften spieler1530 uhr m228nnerab 15 eurodassum 0500bisschennews amp mediavor veranstaltungsbeginnder hauptrundefolgetages im tarifgebietseptember liveuhr desampspieltedeutscheebenfallsnoch ein paarpressespiegelalleseinuhr aufwwwticketmasterde tickethotlineneueeuroanruf inklbundestrainervolleyballhighlight derlive abhat denspielhallenulsamscmsmediagalleryitemlistbevor die teamsbundesliga vblausvolleyball bundesligaeinmvp clubs ampchampionsneuen saison bevorstundenopacity0wochenendecaerste volleyballhighlight derwer istfindestmit der05006visibility hidden opacityrichtig gutesamp media252berwir nochvolleyballemtoppartienden verkehrsmittelnscoresden volleyball supercupmittwochabendjung gesch228ftsf252hrerdaalderopdiemobilfunknetzen die eintrittskarteninklexklusivinteressante faktenarena060am sonntageuroanruferh228ltlichvs vfb friedrichshafenhannover aufeinanderpr228sentiertarchivtvuhr live ssc3kommtvs allianz mtvvblnewshiddenrecycling volleysdreiulsamscmsmediagalleryitemlist li visibilitymeister ergebnisse mvptui arena hannoverim deutschenmnationalmannschaftallianz mtv stuttgartuhr frauen sscpalmbergbei der2 bundesleague01806999 0000hidden opacitysteigtspielerinnenwwweventimdedrei tagen steigtverkehrsmitteln derfrauen ssc palmbergerh228ltlich 020 euroanrufpressespiegel scoresallianz mtvnordcupmax 060 euroanruftreffen haben wirauf sport1d252rfenclubmannschafthier findestnochmit denveranstaltungsbeginnauch dievolleys vsdrei stunden vorspielergutesrecyclingvilsbiburgspielerin hierersteuhr live dresdnerspielplan mvpclubs amp spielerdes gro223raumverkehr hannovereintrittskarten f252r denergebnisse mvpamp statspotsdamroten rabennewsarchiv pressespiegelf252r den supercup2017 1300 uhrberlin recyclingwwwticketmasterde tickethotline 01806999zumuhr frauen11vs vfbrabender supercupsteigt das erstespielplan mvp clubsfrauengelten abnews newsarchivfunctionbisschen angeberwissen060 euroanruf inklchallengemnner2017 1300visibilityhidden opacity0spielenews newsarchiv pressespiegelspielerinnen spielhallendemein paarpokal8zuschauernicht252ber wwwticketmasterde tickethotlineistgebendu einab 15vfbf252r dieder tui arenasupercup geltengleichvfb friedrichshafeninteressantemittwoch 18 oktoberdeutscher13ergebnisse mvp 2wiezehnhier findest dubundesliga dervielehauptrunde 201718visibility hiddenm228nnerfindest du ein15 euro f252r020 euroanruf inkl01806570070 erh228ltlich 020festnetzenevent supercup vblnewsspieldetails101900 uhrspieler mannschafteneinenauf denveranstaltungsbeginn bissrichtigvssteigt dasanimationdelay 5shannover sind 252berlive dresdner01806570070 erh228ltlichclubsfrauen livehannover als fahrausweisenewsarchivinsnuraufeinanderder gvhpartnersupercupein sehrmvp 2 bundesligaim freetvlive auf sport1sportartab drei stunden14max 0600000haben wir nochticketshannover aufeinander treffendeutschenanimationnamerotenvolleyball supercupspieltag mittwochseinerexklusiv imtabelleeuro f252r denfansteamallianz5gro223raumverkehr hannover alsdie teams amroten raben vilsbiburgbundesligalive dresdner scaserbaidschanstuttgart cavolleys vs vfbanimationiterationcountbundestrainer andrea giani15 euroopacity 0saison bevor diesonntag in hannoverim tarifgebiet desfrmusshannover alsdie fansder frauen livesupercup vblnewsnewsarchiv pressespiegel scoresmit4das erste1900 uhr liveam mittwochwer ist dievbltagen steigt das1530 uhr252ber wwwticketmasterdeseinespieler mannschaften spielerinnengro223raumverkehrdie eintrittskartender neuen saisonder frauenndashmediaarena hannoverdes folgetageshomederzusammenmedia news newsarchivdie teamsdrei tagenbereitstabelle spielplan mvptickethotline 01806999 0000amp spielermittwoch 18spielplangvhpartnerinternationaldeutschen mobilfunknetzen dieschwerin vs allianzdie volleyball bundesligasebastiansaisonbundesab dreiuhr auf sport1am mittwoch 18unsnachbisca 1530 uhrtabelle spielplandresdnerdas erste volleyballhighlightmwst auslivesonntagmobilfunknetzenmannschaften spielerinnen spielhallenuhr m228nnerdie volleyball0500 uhr desumwir noch einsof252raus denbevorfolgetages imarchiv meister ergebnisseaus demein bisschenaufeinander treffen habenaus den festnetzenteams020 euroanrufeinestreffentreffen habeneintrittskarten f252rdustats tabelle spielplanfernsehenexklusiv im freetvvisibilityvisible opacity1tuiarenaf252r dennoch eindu ein bisschenli visibility hidden2 bundesligamalinfinite animationnamesport1 und sport1den supercup geltenvomaus den deutschensaison bevormeister ergebnissemtv stuttgart2 bundes ligaein bisschen angeberwissenhannoversdbundesliga der frauenmtvkrommbundes ligastuttgartbrvolleyball supercup 20171mansind 252bergianiamp stats tabellemaxclubs amplive und exklusiveuroanruf inkl mwststatsspieler spielhalleninkl mwst ausnewshaben sichfindest du10spartievisibilityvisiblemannschaften spieler020abtuitischerstats tabelleeuro f252roktobervergangenenbevor dieveranstaltungsbeginn bis umpressespiegel scores ampden deutschen mobilfunknetzendeutschen fernsehengegen dendesjungsscvorandrea gianizweianimationdelay 0slive im freetvstunden voraufschlagwer hatmannschaftenden festnetzenuhrmvphaben wirssc palmberg schwerin0 animationiterationcount infiniteauf demgro223eneinemwerdenaufeinander treffenkeyframesbis um 0500uhr live0 animationiterationcount5sschwerinaufhierfriedrichshafen in derweiterenmwstchampions leaguemit einemder volleyballzuden verkehrsmitteln dermetererste volleyballhighlightdes folgetages imergebnissesupercup 2017den festnetzen maxspielhallen archiv22 september liveein paar interessantetarifgebiet desamp spieler mannschaftenertickethotline 01806999mobilfunknetzen diedie eintrittskarten f252rpalmberg schwerin vsoderspielsichden supercuptagen steigtnewssc palmbergerstenfreetvanimationiterationcount infiniteeintrittskartentitelverteidigervolleyballhighlightstartetdennvolleyballfestnetzen maxspielerinlive aufinfinitebeimist diehannover sind7paarca 15302neuenam1300 uhrwennder tuieintrittskarten abarchiv meisterlive sscsc potsdamsinddrei stundenschwerin vsspielerin hier findestberlin recycling volleysdas eventfolgetagesdes gro223raumverkehrder volleyball bundesligatarifgebietverkehrsmitteln der gvhpartner0saus deraufschlag wer istwwweventimde 01806570070live ssc palmbergandreafahrausweisegegenlifriedrichshafenvor demdie vblanimationiterationcount infinite animationnametickethotlinesehrvaresopacity1als fahrausweisevonhatmannschaften spieler spielhallen01806999aufschlag werwwweventimde 01806570070 erh228ltlicheventder neuenden deutschenneuen saisonlive imsport1erh228ltlich 020m228nner berlinberlininkl mwst spieldetailsdeutschlandmachenspielhallen archiv meisterhabenamp media newsmannschaften spielerinnenevent supercupbis umli visibilitywird essport1 im freetvmeisteralssupercup 2017 1300partienarena hannover sinddresdner sctui arenadeutschen mobilfunknetzeneintrittskarten ab 15faktenscores ampmwst aus dendaf252rpremiereden volleyballmtv stuttgart cauhr m228nner berlinanimationdurationwirdmnner 2sagt01806570070freuensind 252ber wwwticketmasterdeuhr des folgetagesj252ngstegeltensupercup gelten abum 0500 uhrbeim supercupihreangeberwisseneinerstehtum diepalmberg schweringesch228ftsf252hrerraben vilsbiburg18 oktober060 euroanrufrecycling volleys vsimeurodabei22 septemberverkehrsmittelnhauptrundegelten ab dreif252r den volleyballfrauen sscschonligamedia newsvisibilitybundestrainer andreamittwochvs allianzviereineopacityopacity 0 animationiterationcountvolleysgewannwerim tarifgebietpartnervolleyballhighlight der neuenmvp 2fahrausweise in denstunden vor veranstaltungsbeginn0sctarifgebiet des gro223raumverkehrsport1 imnews ampvor veranstaltungsbeginn bis0000 und wwweventimdeprsentierttagen0500 uhrmvp clubsteams amspieltagdenbeiwer hat denvolleyball bundesliga vblwwwticketmasterdestuttgart ca 1530festnetzen max 060ulsamscmsmediagalleryitemlist livolleyball bundesliga der

Longtail Keyword Density for Volleyball-bundesliga.de

KeywordsOccurences
ssc palmberg schwerin16
allianz mtv stuttgart11
der volleyball bundesliga9
die volleyball bundesliga7
bundesliga der frauen7
volleyball bundesliga der7
1900 uhr live7
berlin recycling volleys6
stats tabelle spielplan6
meister ergebnisse mvp6
archiv meister ergebnisse6
amp spieler mannschaften6
clubs amp spieler6
tabelle spielplan mvp6
den volleyball supercup6
amp stats tabelle6
amp media news6
pressespiegel scores amp6
newsarchiv pressespiegel scores6
euroanruf inkl mwst6
news newsarchiv pressespiegel6
media news newsarchiv6
inkl mwst aus6
mwst aus den6
volleyball supercup 20176
scores amp stats6
news amp media6
f252r den volleyball5
der neuen saison5
der tui arena5
verkehrsmitteln der gvh-partner4
den verkehrsmitteln der4
event supercup vbl-news4
hannover als fahrausweise4
live auf sport14
gro223raum-verkehr hannover als4
mittwoch 18 oktober4
fahrausweise in den4
ab 15 euro4
am mittwoch 184
spielhallen archiv meister4
sonntag in hannover4
2 bundes- liga4
spielplan mvp clubs4
roten raben vilsbiburg4
mvp clubs amp4
live im free-tv4
live und exklusiv4
den supercup gelten3
vor veranstaltungsbeginn bis3
020 euroanruf inkl3
aus den festnetzen3
den festnetzen max3
stunden vor veranstaltungsbeginn3
drei stunden vor3
ab drei stunden3
gelten ab drei3
supercup gelten ab3
deutschen mobilfunknetzen die3
mobilfunknetzen die eintrittskarten3
festnetzen max 0603
veranstaltungsbeginn bis um3
den deutschen mobilfunknetzen3
aus den deutschen3
f252r den supercup3
max 060 euroanruf3
eintrittskarten f252r den3
die eintrittskarten f252r3
060 euroanruf inkl3
ulsamscmsmediagalleryitemlist li visibility3
steigt das erste3
bis um 05003
neuen saison bevor3
ein paar interessante3
noch ein paar3
wir noch ein3
haben wir noch3
treffen haben wir3
aufeinander treffen haben3
hannover aufeinander treffen3
teams am sonntag3
die teams am3
bevor die teams3
saison bevor die3
volleyball-highlight der neuen3
um 0500 uhr3
erste volleyball-highlight der3
das erste volleyball-highlight3
01806-570070 erh228ltlich 0203
tagen steigt das3
drei tagen steigt3
des gro223raum-verkehr hannover3
tarifgebiet des gro223raum-verkehr3
im tarifgebiet des3
folgetages im tarifgebiet3
des folgetages im3
uhr des folgetages3
0500 uhr des3
erh228ltlich 020 euroanruf3
mtv stuttgart ca3
wwweventimde 01806-570070 erh228ltlich3
volleyball bundesliga vbl3
hier findest du3
spielerin hier findest3
wer ist die3
aufschlag wer ist3
wer hat den3
live dresdner sc3
uhr live dresdner3
live ssc palmberg3
uhr live ssc3
sport1 und sport13
22 september live3
uhr auf sport13
sport1 im free-tv3
du ein bisschen3
exklusiv im free-tv3
der frauen live3
mvp 2 bundesliga3
ergebnisse mvp 23
mannschaften spieler spielhallen3
spieler mannschaften spieler3
mannschaften spielerinnen spielhallen3
spieler mannschaften spielerinnen3
animation-iteration-count infinite animation-name3
0 animation-iteration-count infinite3
opacity 0 animation-iteration-count3
hidden opacity 03
visibility hidden opacity3
findest du ein3
ein bisschen angeber-wissen3
0000 und wwweventimde3
uhr m228nner berlin3
tickethotline 01806-999 00003
wwwticketmasterde tickethotline 01806-9993
252ber wwwticketmasterde tickethotline3
sind 252ber wwwticketmasterde3
hannover sind 252ber3
arena hannover sind3
tui arena hannover3
friedrichshafen in der3
vs vfb friedrichshafen3
volleys vs vfb3
recycling volleys vs3
m228nner berlin recycling3
1530 uhr m228nner3
eintrittskarten ab 153
ca 1530 uhr3
stuttgart ca 15303
li visibility hidden3
vs allianz mtv3
schwerin vs allianz3
palmberg schwerin vs3
frauen ssc palmberg3
uhr frauen ssc3
1300 uhr frauen3
2017 1300 uhr3
supercup 2017 13003
euro f252r den3
15 euro f252r3
bundestrainer andrea giani3
volleyball bundesliga22
ssc palmberg16
palmberg schwerin16
im free-tv14
volleyball supercup14
1900 uhr11
vfb friedrichshafen11
uhr live11
mtv stuttgart11
f252r den11
allianz mtv11
der frauen11
der volleyball11
auf sport110
am sonntag10
f252r die10
aus der8
bundesliga der7
ist die7
die volleyball7
spieltag mittwoch7
supercup vbl-news6
ergebnisse mvp6
meister ergebnisse6
archiv meister6
den volleyball6
supercup 20176
spieler mannschaften6
media news6
aus den6
mwst aus6
inkl mwst6
euroanruf inkl6
recycling volleys6
berlin recycling6
wird es6
bundes- liga6
amp spieler6
amp media6
news amp6
der neuen6
tabelle spielplan6
newsarchiv pressespiegel6
pressespiegel scores6
clubs amp6
scores amp6
amp stats6
news newsarchiv6
spielplan mvp6
stats tabelle6
neuen saison5
beim supercup5
dresdner sc5
tui arena5
um die5
auf den5
das event5
der tui5
-- spieldetails5
raben vilsbiburg5
live im5
18 oktober4
der supercup4
auf dem4
der gvh-partner4
uhr auf4
spielhallen archiv4
22 september4
2 bundes-4
mvp clubs4
wer hat4
den supercup4
sc potsdam4
2 bundesliga4
1530 uhr4
event supercup4
mittwoch 184
ein paar4
verkehrsmitteln der4
mit seiner4
den verkehrsmitteln4
live auf4
als fahrausweise4
am mittwoch4
bei der4
hannover als4
gro223raum-verkehr hannover4
gegen den4
15 euro4
ab 154
andrea giani4
roten raben4
vor veranstaltungsbeginn3
0500 uhr3
veranstaltungsbeginn bis3
bis um3
um 05003
stunden vor3
eintrittskarten f252r3
drei stunden3
ab drei3
gelten ab3
supercup gelten3
die eintrittskarten3
mobilfunknetzen die3
deutschen mobilfunknetzen3
den deutschen3
060 euroanruf3
max 0603
festnetzen max3
den festnetzen3
animation-delay 0s3
animation-delay 5s3
ulsamscmsmediagalleryitemlist li3
uhr des3
steigt das3
des folgetages3
aufeinander treffen3
bundestrainer andrea3
richtig gutes3
vor dem3
mit der3
die fans3
haben sich3
visibilityvisible opacity13
paar interessante3
noch ein3
wir noch3
haben wir3
treffen haben3
hannover aufeinander3
folgetages im3
teams am3
die teams3
bevor die3
saison bevor3
volleyball-highlight der3
erste volleyball-highlight3
das erste3
020 euroanruf3
tagen steigt3
drei tagen3
des gro223raum-verkehr3
tarifgebiet des3
im tarifgebiet3
li visibility3
hidden opacity3
erh228ltlich 0203
mvp 23
ein bisschen3
du ein3
findest du3
hier findest3
spielerin hier3
wer ist3
aufschlag wer3
hat den3
mannschaften spieler3
spieler spielhallen3
interessante fakten3
live dresdner3
live ssc3
september live3
mnner 23
champions league3
live ab3
mit den3
bundesliga vbl3
ein sehr3
die vbl3
frauen live3
jung gesch228ftsf252hrer3
exklusiv im3
auch die3
im deutschen3
sport1 im3
deutschen fernsehen3
der hauptrunde3
hauptrunde 2017183
visibilityhidden opacity03
spielerinnen spielhallen3
01806-570070 erh228ltlich3
uhr m228nner3
wwweventimde 01806-5700703
01806-999 00003
tickethotline 01806-9993
wwwticketmasterde tickethotline3
252ber wwwticketmasterde3
sind 252ber3
hannover sind3
arena hannover3
visibility hidden3
vs vfb3
volleys vs3
opacity 03
0 animation-iteration-count3
m228nner berlin3
ca 15303
mit einem3
stuttgart ca3
vs allianz3
schwerin vs3
frauen ssc3
uhr frauen3
1300 uhr3
2017 13003
euro f252r3
eintrittskarten ab3
aus dem3
animation-iteration-count infinite3
infinite animation-name3
der tui-arena3
mannschaften spielerinnen3
bisschen angeber-wissen3
der120
die114
den54
im40
volleyball39
supercup38
auf34
mit33
uhr32
live32
f252r31
am29
bundesliga28
das28
ist27
frauen25
sport123
amp22
aus22
sich21
ab21
ein20
um19
schwerin19
wird18
zu18
ssc17
als17
dem17
ndash16
palmberg16
free-tv16
auch16
es16
hannover16
gegen14
014
des14
news14
oktober13
stuttgart13
bei13
mvp13
liga13
meister12
friedrichshafen12
mtv12
112
mittwoch12
zum12
berlin12
spieler12
von11
sonntag11
beim11
werden11
haben11
eine11
noch11
sind11
211
allianz11
vor11
vfb11
sc10
bis10
event10
vbl-news10
saison10
spieltag10
giani9
hat9
mnner9
vom9
39
vbl9
deutschen9
sportdeutschlandtv9
wer8
spielplan8
teams8
mannschaften8
volleys8
48
animation-delay8
pokalsieger7
sehr7
vs7
drei7
mal7
neuen7
september7
wir7
57
tabelle7
spielhallen7
media7
bundestrainer7
dabei6
inkl6
recycling6
newsarchiv6
euroanruf6
meter6
ergebnisse6
einen6
scores6
m228nner6
hauptrunde6
clubs6
66
schon6
fans6
mwst6
eintrittskarten6
deutschland6
alle6
pressespiegel6
archiv6
stats6
bundes-6
dresdner5
jung5
zuschauer5
75
partner5
sagt5
einem5
252ber5
spieldetails5
exklusiv5
gutes5
nicht5
interessante5
sein5
raben5
--5
spielerinnen5
seiner5
vilsbiburg5
spiele5
arena5
euro5
einer5
tui5
steigt4
tickets4
partie4
potsdam4
viele4
84
home4
aufschlag4
bereits4
94
vier4
er4
zwei4
team4
br4
nord4
spielerin4
erh228ltlich4
sd4
nach4
pusic4
denn4
gelten4
hier4
pokal4
fahrausweise4
cup4
paar4
wie4
gro223raum-verkehr4
tv4
treffen4
champions4
roten4
sebastian4
zehn4
deutsche4
international4
ersten4
partien4
andrea4
gro223en4
gesch228ftsf252hrer4
geben4
gvh-partner4
titelverteidiger4
steht4
fernsehen4
verkehrsmitteln4
so4
tagen4
nur4
function3
spiel3
00003
veranstaltungsbeginn3
machen3
wwwticketmasterde3
01806-9993
clubmannschaft3
tickethotline3
wwweventimde3
spielte3
05003
richtig3
folgetages3
gewann3
d252rfen3
zusammen3
bevor3
var3
mobilfunknetzen3
0603
max3
volleyball-highlight3
festnetzen3
eines3
vergangenen3
01806-5700703
stunden3
wochenende3
s3
aufeinander3
0203
oder3
erste3
tarifgebiet3
new3
ca3
infinite3
weiteren3
premiere3
startet3
pr228sentiert3
mittwochabend3
toppartien3
fr3
prsentiert3
uns3
challenge3
league3
animation-duration3
animation-name3
animation-iteration-count3
sportart3
opacity3
hidden3
visibility3
li3
ulsamscmsmediagalleryitemlist3
10s3
5s3
0s3
opacity13
visibilityvisible3
opacity03
visibilityhidden3
keyframes3
dass3
deutscher3
103
angeber-wissen3
daf252r3
man3
daalderop3
113
nationalmannschaft3
tischer3
wenn3
tui-arena3
seine3
muss3
ebenfalls3
kromm3
j252ngste3
bisschen3
volleyball-em3
du3
findest3
fakten3
aserbaidschan3
samstag3
ihre3
neue3
123
gleich3
133
143
ins3
freuen3
kommt3
m3

What are the nameservers for volleyball-bundesliga.de?

Volleyball-bundesliga.de Domain Nameserver Information

HostIP AddressCountry
nsa3.schlundtech.de 62.116.159.13Germany Germany
nsb3.schlundtech.de 83.169.55.13Germany Germany
nsc3.schlundtech.de 89.146.248.23Germany Germany
nsd3.schlundtech.de 74.208.254.23Germany Germany

Volleyball-bundesliga.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Volleyball-bundesliga.de is a scam?