/
Checking...Volume.at - Die Eventcommunity: Events, Fotos & Musikmagazin
Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $1,440
Last updated:2020-11-04
Lautstärke zum Lesen! Die coolsten Events & Gewinnspiele, heißesten Interviews, neuesten Alben, und immer aktuellste Konzertfotos, Kino- & Gamesreviews gibt’s hier: Nur bei uns, nur bei VOLUME.
Domain summary
| Domain label | volume |
| Domain extension | at |
| Global Traffic Rank | 0 |
| Statvoo Rating | H |
| Trust Score | Low Trust Score |
| Estimated worth | $1,440 |
| Estimated daily income | $6 |
| Estimated monthly income | $183 |
Rank summary
How is volume.at ranked relative to other sites:
Percentage of visits to volume.at from a search engine:
Frequently Asked Questions (FAQ)
Q: When was Volume.at registered?
A: Volume.at was registered 3 months, 3 weeks, 6 days, 18 hours, 37 minutes, 54 seconds ago on Wednesday, November 4, 2020.
Q: When was the WHOIS for Volume.at last updated?
A: The WHOIS entry was last updated 2 years, 1 week, 2 days, 18 hours, 37 minutes, 54 seconds ago on Wednesday, February 20, 2019.
Q: What are Volume.at's nameservers?
A: DNS for Volume.at is provided by the following nameservers:
- ns2.domainers.de
- ns3.domainers.de
- ns4.domainers.de
- ns1.domainers.de
Q: Who is the registrar for the Volume.at domain?
A: The domain has been registered at NIC-AT.
Q: What is the traffic rank for Volume.at?
A: Volume.at has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Volume.at each day?
A: Volume.at receives approximately 1,038 visitors and 2,076 page impressions per day.
Q: What IP address does Volume.at resolve to?
A: Volume.at resolves to the IPv4 address 136.243.134.28.
Q: In what country are Volume.at servers located in?
A: Volume.at has servers located in the Germany.
Q: What webserver software does Volume.at use?
A: Volume.at is powered by Nginx/1.10.3 webserver.
Q: Who hosts Volume.at?
A: Volume.at is hosted by Hetzner Online GmbH in Germany.
Q: How much is Volume.at worth?
A: Volume.at has an estimated worth of $1,440. An average daily income of approximately $6, which is roughly $183 per month.
Volume.at Reviews
Volume.at Free SEO Report
Website Related Search Terms
Website Inpage Analysis for Volume.at
H1 Headings
1 :- Volume: Events, Fotos und Musikkultur
H2 Headings
5 :- Top of the Volume
- Die neuesten Konzert- und Partyfotos
- Neueste Artikel auf VOLUME.at
- Login to Volume
- Neues Konto erstellen
H3 Headings
31 :- Neu im Kino: Die Misswahl - Der Beginn einer Revolution
- Neu im Kino: Faking Bullshit
- Nova Rock 2021: Line-Up Phase 4 & Day-Line-Up Musicnews 25.09.2020
- Neu im Kino: After Truth
- Der kalte Krieg schickt euch in die Vergangenheit Call Of Duty Black Ops Cold War angekündigt
- Nova Rock 2021: Headliner Announcement Musicnews 25.08.2020
- #OnePassion für die Gamer Advertorial: A1 eSports League X Red Bull PLANet One
- Filmtipp: Tenet
- Gewinne ein VOLUME FreQpackage! You can’t keep us from (dis)DANCING
- Die Games im November prepare for the Next Level of Gaming!
- London ist ein Spielplatz Watch Dogs Legion im Test
- FM4 Frequency 2019: Throwback-Stream Musicnews 19.08.2020
- There's a party on the floor The Jackbox Party Pack 7
- 24. Sep / David B. Volume Filmpremiere: David Copperfield - Einmal Reichtum und zurück @ Apollo - Das Kino
- 17. Sep / Kiki Heindl | Capture the Show Climate Kirtag @ Heldenplatz Wien
- 12. Sep / Kiki Heindl | Capture the Show Rebel HeART Festival 2020 @ Kammgarnsaal Möllersdorf
- 08. Aug / Felix Mitterlehner #SAVETHERAVE Club Kultur Demo @ Heldenplatz Wien
- 05. Aug / David B. Volume Filmpremiere: Marie Curie - Elemente des Lebens @ Apollo - Das Kino
- Back On Track Ride 4
- Halloween im Gaming-Universum Alle In Game Events im Überblick
- The Haunting Of Verdansk Es wird Nacht in der Warzone!
- Insekten sind Freunde - Nicht Tamarin
- All wings reporting in! Star Wars Squadrons im Test
- Fuser präsentiert Paul Van Dyk Set Wohnzimmer Konzert incoming!
- Manchmal muss es seriös sein Serious Sam 4 im Test
- Crash is FINALLY BACK Crash Bandicoot 4: It's about time
- Die Gratis Games im Oktober Race To The Top!
- Sackboy kehrt mit verschiedenen Editionen zurück! Sackboy: A Big Adventure fürs Wohnzimmer
- Die Games im Oktober HOT HOT HOT!
- Assassin's Creed: Valhalla Story Trailer enthüllt Bei Odins Bart!
- Höllisch gutes Rogue-like Hades
H4 Headings
0 :H5 Headings
0 :H6 Headings
0 :Total IFRAMEs
1 :Total Images
31 :Google Adsense
:Not Applicable
Google Analytics
:Not Applicable
Links - Internal
119:- Volume .cls-1{fill:#ED2450;} .cls-2{fill:#FFFFFF;} .st2{fill:#09072E;}
https://www.volume.at - Volume Home
https://www.volume.at/ - Volume Quarantainment
https://www.volume.at/stories/quarantainment/ - Volume Events
http://volume.at/events/ - Volume Eventkalender
https://www.volume.at/events/ - Volume Event eintragen
https://www.volume.at/eventupload - Volume Fotos
http://volume.at/fotos/ - Volume Musik
http://volume.at/musik/ - Volume Musicnews
https://www.volume.at/musik/musicnews/ - Volume Interviews
https://www.volume.at/musik/interviews/ - Volume New Hot Shit
https://www.volume.at/musik/new-hot-shit/ - Volume Album Reviews
https://www.volume.at/musik/album-reviews/ - Volume Stories
http://volume.at/stories/ - Volume Games
http://volume.at/games/ - Volume Win
http://volume.at/win/ - Volume B2B
https://b2b.volume.at - Volume AGB
https://www.volume.at/allgemeine-nutzungsbedingungen/ - Volume Offenlegung
https://www.volume.at/offenlegung/ - Volume Datenschutz
https://www.volume.at/datenschutz/ - Volume Impressum
https://www.volume.at/impressum/ - https://www.volume.at/stories/neu-im-kino-die-misswahl-der-beginn-einer-revolution/
https://www.volume.at/stories/neu-im-kino-die-misswahl-der-beginn-einer-revolution/ - Volume Neu im Kino: Die Misswahl - Der Beginn einer Revolution
https://www.volume.at/stories/neu-im-kino-die-misswahl-der-beginn-einer-revolution/ - Volume Kino
https://www.volume.at/stories/kino/ - https://www.volume.at/stories/neu-im-kino-faking-bullshit/
https://www.volume.at/stories/neu-im-kino-faking-bullshit/ - Volume Neu im Kino: Faking Bullshit
https://www.volume.at/stories/neu-im-kino-faking-bullshit/ - https://www.volume.at/musik/musicnews/nova-rock-2021-line-up-phase-4-day-line-up/
https://www.volume.at/musik/musicnews/nova-rock-2021-line-up-phase-4-day-line-up/ - Volume Nova Rock 2021: Line-Up Phase 4 & Day-Line-Up Musicnews 25.09.2020
https://www.volume.at/musik/musicnews/nova-rock-2021-line-up-phase-4-day-line-up/ - https://www.volume.at/stories/neu-im-kino-after-truth/
https://www.volume.at/stories/neu-im-kino-after-truth/ - Volume Neu im Kino: After Truth
https://www.volume.at/stories/neu-im-kino-after-truth/ - https://www.volume.at/stories/der-kalte-krieg-schickt-euch-in-die-vergangenheit/
https://www.volume.at/stories/der-kalte-krieg-schickt-euch-in-die-vergangenheit/ - Volume Der kalte Krieg schickt euch in die Vergangenheit Call Of Duty Black Ops Cold War angekündigt
https://www.volume.at/stories/der-kalte-krieg-schickt-euch-in-die-vergangenheit/ - Volume Stories
https://www.volume.at/stories/ - Volume Musik
https://www.volume.at/musik - Volume Games
https://www.volume.at/games - Volume Stories
https://www.volume.at/stories - https://www.volume.at/musik/musicnews/nova-rock-2021-headliner-announcement/
https://www.volume.at/musik/musicnews/nova-rock-2021-headliner-announcement/ - Volume Nova Rock 2021: Headliner Announcement Musicnews 25.08.2020
https://www.volume.at/musik/musicnews/nova-rock-2021-headliner-announcement/ - https://www.volume.at/games/onepassion-fuer-die-gamer/
https://www.volume.at/games/onepassion-fuer-die-gamer/ - Volume #OnePassion für die Gamer Advertorial: A1 eSports League X Red Bull PLANet One
https://www.volume.at/games/onepassion-fuer-die-gamer/ - Volume Games
https://www.volume.at/games/ - https://www.volume.at/stories/filmtipp-tenet/
https://www.volume.at/stories/filmtipp-tenet/ - Volume Filmtipp: Tenet
https://www.volume.at/stories/filmtipp-tenet/ - https://www.volume.at/musik/gewinne-ein-volume-freqpackage/
https://www.volume.at/musik/gewinne-ein-volume-freqpackage/ - Volume Gewinne ein VOLUME FreQpackage! You can’t keep us from (dis)DANCING
https://www.volume.at/musik/gewinne-ein-volume-freqpackage/ - Volume Musik
https://www.volume.at/musik/ - https://www.volume.at/games/gaming-news/die-games-im-november-5/
https://www.volume.at/games/gaming-news/die-games-im-november-5/ - Volume Die Games im November prepare for the Next Level of Gaming!
https://www.volume.at/games/gaming-news/die-games-im-november-5/ - Volume Gaming News
https://www.volume.at/games/gaming-news/ - https://www.volume.at/games/reviews/watch-dogs-legion/
https://www.volume.at/games/reviews/watch-dogs-legion/ - Volume London ist ein Spielplatz Watch Dogs Legion im Test
https://www.volume.at/games/reviews/watch-dogs-legion/ - Volume Game Reviews
https://www.volume.at/games/game-reviews/ - https://www.volume.at/musik/musicnews/fm4-frequency-2019-throwback-stream/
https://www.volume.at/musik/musicnews/fm4-frequency-2019-throwback-stream/ - Volume FM4 Frequency 2019: Throwback-Stream Musicnews 19.08.2020
https://www.volume.at/musik/musicnews/fm4-frequency-2019-throwback-stream/ - https://www.volume.at/games/reviews/jackbox-partypark-7/
https://www.volume.at/games/reviews/jackbox-partypark-7/ - Volume There's a party on the floor The Jackbox Party Pack 7
https://www.volume.at/games/reviews/jackbox-partypark-7/ - Volume Alle Fotos
https://www.volume.at/fotos - https://www.volume.at/fotos/volume-filmpremiere-david-copperfield-einmal-reichtum-und-zurueck-2020-09-24/
https://www.volume.at/fotos/volume-filmpremiere-david-copperfield-einmal-reichtum-und-zurueck-2020-09-24/ - Volume David B.
https://www.volume.at/author/david-baon-at/ - Volume Volume Filmpremiere: David Copperfield - Einmal Reichtum und zurück @ Apollo - Das Kino
https://www.volume.at/fotos/volume-filmpremiere-david-copperfield-einmal-reichtum-und-zurueck-2020-09-24/ - Volume 33 Fotos
https://www.volume.at/fotos/volume-filmpremiere-david-copperfield-einmal-reichtum-und-zurueck-2020-09-24/ - https://www.volume.at/fotos/climate-kirtag-heldenplatz-wien-2020-09-17/
https://www.volume.at/fotos/climate-kirtag-heldenplatz-wien-2020-09-17/ - Volume Kiki Heindl | Capture the Show
https://www.volume.at/photographer/kiki_heindl/ - Volume Climate Kirtag @ Heldenplatz Wien
https://www.volume.at/fotos/climate-kirtag-heldenplatz-wien-2020-09-17/ - Volume 101 Fotos
https://www.volume.at/fotos/climate-kirtag-heldenplatz-wien-2020-09-17/ - https://www.volume.at/fotos/rebel-heart-festival-2020-kammgarnsaal-moellersdorf-2020-09-12/
https://www.volume.at/fotos/rebel-heart-festival-2020-kammgarnsaal-moellersdorf-2020-09-12/ - Volume Rebel HeART Festival 2020 @ Kammgarnsaal Möllersdorf
https://www.volume.at/fotos/rebel-heart-festival-2020-kammgarnsaal-moellersdorf-2020-09-12/ - Volume 87 Fotos
https://www.volume.at/fotos/rebel-heart-festival-2020-kammgarnsaal-moellersdorf-2020-09-12/ - https://www.volume.at/fotos/save-the-rave-club-kultur-demo-2020-08-08/
https://www.volume.at/fotos/save-the-rave-club-kultur-demo-2020-08-08/ - Volume Felix Mitterlehner
https://www.volume.at/photographer/felix_mitterlehner/ - Volume #SAVETHERAVE Club Kultur Demo @ Heldenplatz Wien
https://www.volume.at/fotos/save-the-rave-club-kultur-demo-2020-08-08/ - Volume 219 Fotos
https://www.volume.at/fotos/save-the-rave-club-kultur-demo-2020-08-08/ - https://www.volume.at/fotos/volume-filmpremiere-marie-curie-elemente-des-lebens-2020-08-05/
https://www.volume.at/fotos/volume-filmpremiere-marie-curie-elemente-des-lebens-2020-08-05/ - Volume Volume Filmpremiere: Marie Curie - Elemente des Lebens @ Apollo - Das Kino
https://www.volume.at/fotos/volume-filmpremiere-marie-curie-elemente-des-lebens-2020-08-05/ - Volume 28 Fotos
https://www.volume.at/fotos/volume-filmpremiere-marie-curie-elemente-des-lebens-2020-08-05/ - https://www.volume.at/games/reviews/ride-4/
https://www.volume.at/games/reviews/ride-4/ - Volume Back On Track Ride 4
https://www.volume.at/games/reviews/ride-4/ - Volume games-redaktion
https://www.volume.at/author/games-redaktion/ - Volume Weiterlesen
https://www.volume.at/games/reviews/ride-4/ - https://www.volume.at/games/gaming-news/halloween-im-gaming-universum/
https://www.volume.at/games/gaming-news/halloween-im-gaming-universum/ - Volume Halloween im Gaming-Universum Alle In Game Events im Überblick
https://www.volume.at/games/gaming-news/halloween-im-gaming-universum/ - Volume Weiterlesen
https://www.volume.at/games/gaming-news/halloween-im-gaming-universum/ - https://www.volume.at/games/gaming-news/the-haunting-of-verdansk/
https://www.volume.at/games/gaming-news/the-haunting-of-verdansk/ - Volume The Haunting Of Verdansk Es wird Nacht in der Warzone!
https://www.volume.at/games/gaming-news/the-haunting-of-verdansk/ - Volume Weiterlesen
https://www.volume.at/games/gaming-news/the-haunting-of-verdansk/ - https://www.volume.at/games/reviews/tamarin/
https://www.volume.at/games/reviews/tamarin/ - Volume Insekten sind Freunde - Nicht Tamarin
https://www.volume.at/games/reviews/tamarin/ - Volume Nina Z.
https://www.volume.at/author/nina/ - Volume Weiterlesen
https://www.volume.at/games/reviews/tamarin/ - https://www.volume.at/games/reviews/star-wars-squadrons/
https://www.volume.at/games/reviews/star-wars-squadrons/ - Volume All wings reporting in! Star Wars Squadrons im Test
https://www.volume.at/games/reviews/star-wars-squadrons/ - Volume Weiterlesen
https://www.volume.at/games/reviews/star-wars-squadrons/ - https://www.volume.at/games/gaming-news/fuser-praesentiert-paul-van-dyk-set/
https://www.volume.at/games/gaming-news/fuser-praesentiert-paul-van-dyk-set/ - Volume Fuser präsentiert Paul Van Dyk Set Wohnzimmer Konzert incoming!
https://www.volume.at/games/gaming-news/fuser-praesentiert-paul-van-dyk-set/ - Volume Weiterlesen
https://www.volume.at/games/gaming-news/fuser-praesentiert-paul-van-dyk-set/ - https://www.volume.at/games/reviews/serious-sam-4/
https://www.volume.at/games/reviews/serious-sam-4/ - Volume Manchmal muss es seriös sein Serious Sam 4 im Test
https://www.volume.at/games/reviews/serious-sam-4/ - Volume Weiterlesen
https://www.volume.at/games/reviews/serious-sam-4/ - https://www.volume.at/games/reviews/crash-bandicoot-4-its-about-time/
https://www.volume.at/games/reviews/crash-bandicoot-4-its-about-time/ - Volume Crash is FINALLY BACK Crash Bandicoot 4: It's about time
https://www.volume.at/games/reviews/crash-bandicoot-4-its-about-time/ - Volume Weiterlesen
https://www.volume.at/games/reviews/crash-bandicoot-4-its-about-time/ - https://www.volume.at/games/gaming-news/gratis-games-oktober/
https://www.volume.at/games/gaming-news/gratis-games-oktober/ - Volume Die Gratis Games im Oktober Race To The Top!
https://www.volume.at/games/gaming-news/gratis-games-oktober/ - Volume Weiterlesen
https://www.volume.at/games/gaming-news/gratis-games-oktober/ - https://www.volume.at/games/gaming-news/sackboy-kehrt-mit-verschiedenen-editionen-zurueck/
https://www.volume.at/games/gaming-news/sackboy-kehrt-mit-verschiedenen-editionen-zurueck/ - Volume Sackboy kehrt mit verschiedenen Editionen zurück! Sackboy: A Big Adventure fürs Wohnzimmer
https://www.volume.at/games/gaming-news/sackboy-kehrt-mit-verschiedenen-editionen-zurueck/ - Volume Weiterlesen
https://www.volume.at/games/gaming-news/sackboy-kehrt-mit-verschiedenen-editionen-zurueck/ - https://www.volume.at/games/gaming-news/die-games-im-oktober-5/
https://www.volume.at/games/gaming-news/die-games-im-oktober-5/ - Volume Die Games im Oktober HOT HOT HOT!
https://www.volume.at/games/gaming-news/die-games-im-oktober-5/ - Volume Weiterlesen
https://www.volume.at/games/gaming-news/die-games-im-oktober-5/ - https://www.volume.at/games/gaming-news/assassins-creed-valhalla-story-trailer-enthuellt/
https://www.volume.at/games/gaming-news/assassins-creed-valhalla-story-trailer-enthuellt/ - Volume Assassin's Creed: Valhalla Story Trailer enthüllt Bei Odins Bart!
https://www.volume.at/games/gaming-news/assassins-creed-valhalla-story-trailer-enthuellt/ - Volume Weiterlesen
https://www.volume.at/games/gaming-news/assassins-creed-valhalla-story-trailer-enthuellt/ - https://www.volume.at/games/reviews/hoellisch-gutes-rogue-like/
https://www.volume.at/games/reviews/hoellisch-gutes-rogue-like/ - Volume Höllisch gutes Rogue-like Hades
https://www.volume.at/games/reviews/hoellisch-gutes-rogue-like/ - Volume Martin Hammerl
https://www.volume.at/author/martin-hammerl/ - Volume Weiterlesen
https://www.volume.at/games/reviews/hoellisch-gutes-rogue-like/ - Volume Datenschutzerklärung
http://volume.at/datenschutz/ - Volume Passwort vergessen?
https://www.volume.at/account/recovery/ - Volume Nutzungsbedingungen
http://volume.at/allgemeine-nutzungsbedingungen/
Links - Internal (nofollow)
0:Links - Outbound
2:- http://facebook.com/volume.at
http://facebook.com/volume.at - http://www.instagram.com/volume.at/
http://www.instagram.com/volume.at/
Links - Outbound (nofollow)
0:Keyword Cloud for Volume.at
warzoneokt vondueinestarallemusikneuebei10 okt vonhadeshabengratis gamesdochdesimfr die0musicnewszunach10 okteintamarinwirwirdzeitgamevon davidkinostoriesdieweiterlesen windowdatalayernochsepoktobervon gamesredaktiongame reviewsvongeschrieben am 10helliphellip weiterlesengeschriebenfotos windowdatalayersamwargames im oktoberbandicootokteventswindowdatalayer windowdatalayerabenteuercrash bandicootneukino windowdatalayerendlichdavidamdasnewsgamesredaktionmitkonzertderneuenalsvon nina zzam 10 oktokt von davidfotosodercrashim testeinemvon david bbiggamesmusicnews windowdatalayer20 okt vondemvon ninafrsichgaming newswindowdatalayeram 20weiterlesen20 oktam 10weiterlesen windowdatalayer windowdatalayerneu im kinohotgratisokt von gamesredaktionhellip weiterlesen windowdatalayerim oktobergeschrieben am 20bkontofotos windowdatalayer windowdatalayerdengamingesnichtfusermusicnews windowdatalayer windowdatalayerzurckgames imimmeram 20 oktim kinovolumedrfensindkehrtwohnzimmerkino windowdatalayer windowdatalayerninapassworttestwiederauchnina zdavid bumdeshalbauf1istsackboygeschrieben amneu im2neuesreviews
Longtail Keyword Density for Volume.at
Who hosts Volume.at?
Volume.at Hosting Provider Information
| Hosted IP Address: | 136.243.134.28 |
| Hosted Hostname: | newton.volume.at |
| Service Provider: | Hetzner Online GmbH |
| Hosted Country: |  DE |
| Location Latitude: | 51.2993 |
| Location Longitude: | 9.491 |
| Webserver Software: | nginx/1.10.3 |
Is "Hetzner Online GmbH" in the Top 10 Hosting Companies?
Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
Hetzner Online GmbH
1.2092%
HTTP Header Analysis for Volume.at
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Server: | nginx/1.10.3 |
| Date: | Wed, 04 Nov 2020 00:01:29 GMT |
| Content-Type: | text/html |
| Last-Modified: | Mon, 02 Nov 2020 13:36:05 GMT |
| Transfer-Encoding: | chunked |
| Connection: | keep-alive |
| Vary: | Accept-Encoding |
| ETag: | W/"5fa00b45-16ad8" |
| Expires: | Wed, 04 Nov 2020 01:01:29 GMT |
| Cache-Control: | max-age=3600, public |
| Pragma: | public |
| Content-Encoding: | gzip |
Volume.at Domain Nameserver Information
| Host | IP Address | Country |
|---|---|---|
| ns2.domainers.de | 95.130.17.218 | |
| ns3.domainers.de | 217.146.22.194 | |
| ns4.domainers.de | 144.76.91.137 | |
| ns1.domainers.de | 95.130.16.246 |
Need to find out who hosts Volume.at?
Domain Registration (WhoIs) information for Volume.at
% Copyright (c)2020 by NIC.AT (1)
%
% Restricted rights.
%
% Except for agreed Internet operational purposes, no part of this
% information may be reproduced, stored in a retrieval system, or
% transmitted, in any form or by any means, electronic, mechanical,
% recording, or otherwise, without prior permission of NIC.AT on behalf
% of itself and/or the copyright holders. Any use of this material to
% target advertising or similar activities is explicitly forbidden and
% can be prosecuted.
%
% It is furthermore strictly forbidden to use the Whois-Database in such
% a way that jeopardizes or could jeopardize the stability of the
% technical systems of NIC.AT under any circumstances. In particular,
% this includes any misuse of the Whois-Database and any use of the
% Whois-Database which disturbs its operation.
%
% Should the user violate these points, NIC.AT reserves the right to
% deactivate the Whois-Database entirely or partly for the user.
% Moreover, the user shall be held liable for any and all damage
% arising from a violation of these points.
domain: volume.at
registrar: Domainers Registrar GmbH ( https://nic.at/registrar/668 )
registrant: VMVG11839175-NICAT
tech-c: VMVG11839175-NICAT
nserver: ns1.domainers.de
nserver: ns2.domainers.de
nserver: ns3.domainers.de
nserver: ns4.domainers.de
changed: 20190220 20:54:31
source: AT-DOM
personname: Michael Ledl
organization: Volume Media Verlags GmbH
street address: Universitaetsstrasse 4/5
postal code: 1090
city: Wien
country: Austria
phone: +431961074814
e-mail: Login to show email
VMVG11839175-NICAT
changed: 20180412 13:32:34
source: AT-DOM
Websites with Similar Names
Volum-7.com
Volum 7 Disseny, S.L.
Volum 7 Disseny, S.L.
Volum-bust.com
Deze domeinnaam is gereserveerd - Flexwebhosting
Deze domeinnaam is gereserveerd - Flexwebhosting
Volum.info
volum.info - For Sale!
volum.info - For Sale!
Volum.io
Volum | Volum
Volum | Volum
Volum8.co
Home - Volum8 Creative, Inc.
Home - Volum8 Creative, Inc.
Volumage.com
Welcome to VOLUMAGE.COM
Welcome to VOLUMAGE.COM
Volumaileasy.com
volumaileasy.com is available for purchase - Sedo.com
volumaileasy.com is available for purchase - Sedo.com
Volumaitrise.com
Just a moment...
Just a moment...
Recently Updated Websites
Winsoftware24.de (1 second ago.), Gentlemensward.com (3 seconds ago.), Aura-london.com (5 seconds ago.), Prospecttechlabs.com (6 seconds ago.), Notedistile.org (6 seconds ago.), Strong-encryption.com (8 seconds ago.), Gaveloftet.no (8 seconds ago.), Magen-darm-grippe.info (9 seconds ago.), Havenacupuncture.com (9 seconds ago.), Opescapitalgroup.com (10 seconds ago.), Timhortons.cc (11 seconds ago.), Paulschieldtcb.com (12 seconds ago.), Basakmetalurji.com.tr (12 seconds ago.), Pray.city (12 seconds ago.), Christonthecrapper.com (13 seconds ago.), Rleinformatica.com (14 seconds ago.), Architecturaldetail.net (17 seconds ago.), Bqik.net (17 seconds ago.), Stbfoerster.com (17 seconds ago.), Foborentals.com (17 seconds ago.), Promogramme.com (18 seconds ago.), Icestinataledellacasa.com (24 seconds ago.), Cootransrio.online (26 seconds ago.), Basecarnp.com (27 seconds ago.), Deserttobeaches.com (31 seconds ago.), Passarela.net (32 seconds ago.), Epitoanyag-online.hu (33 seconds ago.), Beef-ager.info (35 seconds ago.), Ludwig-zwei-forschung.de (35 seconds ago.), Brandjuice.studio (37 seconds ago.),
Recently Searched Keywords
newsmax (1 second ago.), help page (1 second ago.), protecting your privacy (1 second ago.), cost management (2 seconds ago.), etpbbuttonhover letter-spacing0px (6 seconds ago.), 画廊 (6 seconds ago.), (secret link) (7 seconds ago.), lifelike sex doll (8 seconds ago.), hawk helmets replacement parts (11 seconds ago.), sales comm.module (12 seconds ago.), 181 1 (12 seconds ago.), true isfitwidth true (13 seconds ago.), statementratio100optionpersuasive (14 seconds ago.), marka danışmanı (15 seconds ago.), lichess (15 seconds ago.), rarr liubomyrkuzmiak 0 (15 seconds ago.), 高考英语习题精选--阅读理解 (16 seconds ago.), 도장을 찍어주세요 (17 seconds ago.), xamarin forms datepicker (20 seconds ago.), 觅友 (21 seconds ago.), imagine injection at the goodguys 22nd speedway motors southwest nationals (24 seconds ago.), leonardo da (26 seconds ago.), school house (27 seconds ago.), 保价服务 (28 seconds ago.), fmcsa clearinghouse registration guide (29 seconds ago.), sap business one (29 seconds ago.), tips membeli lampu led langsung dari supplier (30 seconds ago.), gp75 leopard (32 seconds ago.), newandused (33 seconds ago.), hartford ct (35 seconds ago.),
