Volume.at - Die Eventcommunity: Events, Fotos & Musikmagazin

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $1,440
Last updated:2020-11-04

Lautstärke zum Lesen! Die coolsten Events & Gewinnspiele, heißesten Interviews, neuesten Alben, und immer aktuellste Konzertfotos, Kino- & Gamesreviews gibt’s hier: Nur bei uns, nur bei VOLUME.


Domain summary

Domain label
volume
Domain extension
at
Global Traffic Rank
0
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,440
Estimated daily income
$6
Estimated monthly income
$183

Rank summary

How is volume.at ranked relative to other sites:

Percentage of visits to volume.at from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Volume.at registered?
A: Volume.at was registered 3 months, 3 weeks, 6 days, 18 hours, 37 minutes, 54 seconds ago on Wednesday, November 4, 2020.
Q: When was the WHOIS for Volume.at last updated?
A: The WHOIS entry was last updated 2 years, 1 week, 2 days, 18 hours, 37 minutes, 54 seconds ago on Wednesday, February 20, 2019.
Q: What are Volume.at's nameservers?
A: DNS for Volume.at is provided by the following nameservers:
  • ns2.domainers.de
  • ns3.domainers.de
  • ns4.domainers.de
  • ns1.domainers.de
Q: Who is the registrar for the Volume.at domain?
A: The domain has been registered at NIC-AT.
Q: What is the traffic rank for Volume.at?
A: Volume.at has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Volume.at each day?
A: Volume.at receives approximately 1,038 visitors and 2,076 page impressions per day.
Q: What IP address does Volume.at resolve to?
A: Volume.at resolves to the IPv4 address 136.243.134.28.
Q: In what country are Volume.at servers located in?
A: Volume.at has servers located in the Germany.
Q: What webserver software does Volume.at use?
A: Volume.at is powered by Nginx/1.10.3 webserver.
Q: Who hosts Volume.at?
A: Volume.at is hosted by Hetzner Online GmbH in Germany.
Q: How much is Volume.at worth?
A: Volume.at has an estimated worth of $1,440. An average daily income of approximately $6, which is roughly $183 per month.

Volume.at Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Volume.at Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Volume.at

H1 Headings

1 :
  1. Volume: Events, Fotos und Musikkultur

H2 Headings

5 :
  1. Top of the Volume
  2. Die neuesten Konzert- und Partyfotos
  3. Neueste Artikel auf VOLUME.at
  4. Login to Volume
  5. Neues Konto erstellen

H3 Headings

31 :
  1. Neu im Kino: Die Misswahl - Der Beginn einer Revolution
  2. Neu im Kino: Faking Bullshit
  3. Nova Rock 2021: Line-Up Phase 4 & Day-Line-Up Musicnews 25.09.2020
  4. Neu im Kino: After Truth
  5. Der kalte Krieg schickt euch in die Vergangenheit Call Of Duty Black Ops Cold War angekündigt
  6. Nova Rock 2021: Headliner Announcement Musicnews 25.08.2020
  7. #OnePassion für die Gamer Advertorial: A1 eSports League X Red Bull PLANet One
  8. Filmtipp: Tenet
  9. Gewinne ein VOLUME FreQpackage! You can’t keep us from (dis)DANCING
  10. Die Games im November prepare for the Next Level of Gaming!
  11. London ist ein Spielplatz Watch Dogs Legion im Test
  12. FM4 Frequency 2019: Throwback-Stream Musicnews 19.08.2020
  13. There's a party on the floor The Jackbox Party Pack 7
  14. 24. Sep / David B. Volume Filmpremiere: David Copperfield - Einmal Reichtum und zurück @ Apollo - Das Kino
  15. 17. Sep / Kiki Heindl | Capture the Show Climate Kirtag @ Heldenplatz Wien
  16. 12. Sep / Kiki Heindl | Capture the Show Rebel HeART Festival 2020 @ Kammgarnsaal Möllersdorf
  17. 08. Aug / Felix Mitterlehner #SAVETHERAVE Club Kultur Demo @ Heldenplatz Wien
  18. 05. Aug / David B. Volume Filmpremiere: Marie Curie - Elemente des Lebens @ Apollo - Das Kino
  19. Back On Track Ride 4
  20. Halloween im Gaming-Universum Alle In Game Events im Überblick
  21. The Haunting Of Verdansk Es wird Nacht in der Warzone!
  22. Insekten sind Freunde - Nicht Tamarin
  23. All wings reporting in! Star Wars Squadrons im Test
  24. Fuser präsentiert Paul Van Dyk Set Wohnzimmer Konzert incoming!
  25. Manchmal muss es seriös sein Serious Sam 4 im Test
  26. Crash is FINALLY BACK Crash Bandicoot 4: It's about time
  27. Die Gratis Games im Oktober Race To The Top!
  28. Sackboy kehrt mit verschiedenen Editionen zurück! Sackboy: A Big Adventure fürs Wohnzimmer
  29. Die Games im Oktober HOT HOT HOT!
  30. Assassin's Creed: Valhalla Story Trailer enthüllt Bei Odins Bart!
  31. Höllisch gutes Rogue-like Hades

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

31 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

119:

Links - Internal (nofollow)

0:

Links - Outbound

2:

Links - Outbound (nofollow)

0:

Keyword Cloud for Volume.at

warzoneokt vondueinestarallemusikneuebei10 okt vonhadeshabengratis gamesdochdesimfr die0musicnewszunach10 okteintamarinwirwirdzeitgamevon davidkinostoriesdieweiterlesen windowdatalayernochsepoktobervon gamesredaktiongame reviewsvongeschrieben am 10helliphellip weiterlesengeschriebenfotos windowdatalayersamwargames im oktoberbandicootokteventswindowdatalayer windowdatalayerabenteuercrash bandicootneukino windowdatalayerendlichdavidamdasnewsgamesredaktionmitkonzertderneuenalsvon nina zzam 10 oktokt von davidfotosodercrashim testeinemvon david bbiggamesmusicnews windowdatalayer20 okt vondemvon ninafrsichgaming newswindowdatalayeram 20weiterlesen20 oktam 10weiterlesen windowdatalayer windowdatalayerneu im kinohotgratisokt von gamesredaktionhellip weiterlesen windowdatalayerim oktobergeschrieben am 20bkontofotos windowdatalayer windowdatalayerdengamingesnichtfusermusicnews windowdatalayer windowdatalayerzurckgames imimmeram 20 oktim kinovolumedrfensindkehrtwohnzimmerkino windowdatalayer windowdatalayerninapassworttestwiederauchnina zdavid bumdeshalbauf1istsackboygeschrieben amneu im2neuesreviews

Longtail Keyword Density for Volume.at

KeywordsOccurences
hellip weiterlesen windowdatalayer12
weiterlesen windowdatalayer windowdatalayer12
von david b5
fotos windowdatalayer windowdatalayer5
okt von david5
okt von games-redaktion4
kino windowdatalayer windowdatalayer4
10 okt von3
am 10 okt3
geschrieben am 103
von nina z3
neu im kino3
20 okt von3
am 20 okt3
geschrieben am 203
musicnews windowdatalayer windowdatalayer3
games im oktober3
windowdatalayer windowdatalayer31
geschrieben am13
hellip weiterlesen13
weiterlesen windowdatalayer12
okt von11
gaming news8
game reviews8
david b7
crash bandicoot5
von david5
fotos windowdatalayer5
games im4
am 104
kino windowdatalayer4
von games-redaktion4
10 okt3
nina z3
von nina3
gratis games3
am 203
20 okt3
neu im3
im test3
fr die3
musicnews windowdatalayer3
im kino3
im oktober3
windowdatalayer62
die34
der24
im18
am17
von14
das13
weiterlesen13
hellip13
geschrieben13
okt11
game11
ein11
fr11
zu11
games11
kino10
ist10
volume9
gaming9
reviews9
mit8
news8
oktober8
david8
fotos8
haben7
07
musicnews7
dem7
b7
es6
auch6
sich6
eine6
auf6
crash6
zurck6
15
musik5
um5
sep5
doch5
einem5
bandicoot5
noch5
kehrt4
sam4
nach4
bei4
sackboy4
neuen4
sind4
als4
passwort4
den4
events4
games-redaktion4
hot4
zeit4
drfen4
wieder4
du4
oder4
war4
warzone3
test3
immer3
neu3
gratis3
des3
big3
abenteuer3
stories3
hades3
alle3
konzert3
23
neues3
wohnzimmer3
fuser3
endlich3
wir3
nicht3
star3
z3
nina3
tamarin3
wird3
neue3
deshalb3
konto3

Who hosts Volume.at?

Volume.at Hosting Provider Information

Hosted IP Address:136.243.134.28
Hosted Hostname:newton.volume.at
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx/1.10.3

Is "Hetzner Online GmbH" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
Hetzner Online GmbH
1.2092%

HTTP Header Analysis for Volume.at

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.10.3
Date: Wed, 04 Nov 2020 00:01:29 GMT
Content-Type: text/html
Last-Modified: Mon, 02 Nov 2020 13:36:05 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
ETag: W/"5fa00b45-16ad8"
Expires: Wed, 04 Nov 2020 01:01:29 GMT
Cache-Control: max-age=3600, public
Pragma: public
Content-Encoding: gzip

Volume.at Domain Nameserver Information

HostIP AddressCountry
ns2.domainers.de 95.130.17.218
ns3.domainers.de 217.146.22.194
ns4.domainers.de 144.76.91.137
ns1.domainers.de 95.130.16.246


Need to find out who hosts Volume.at?


Domain Registration (WhoIs) information for Volume.at

 % Copyright (c)2020 by NIC.AT (1)
%
% Restricted rights.
%
% Except for agreed Internet operational purposes, no part of this
% information may be reproduced, stored in a retrieval system, or
% transmitted, in any form or by any means, electronic, mechanical,
% recording, or otherwise, without prior permission of NIC.AT on behalf
% of itself and/or the copyright holders. Any use of this material to
% target advertising or similar activities is explicitly forbidden and
% can be prosecuted.
%
% It is furthermore strictly forbidden to use the Whois-Database in such
% a way that jeopardizes or could jeopardize the stability of the
% technical systems of NIC.AT under any circumstances. In particular,
% this includes any misuse of the Whois-Database and any use of the
% Whois-Database which disturbs its operation.
%
% Should the user violate these points, NIC.AT reserves the right to
% deactivate the Whois-Database entirely or partly for the user.
% Moreover, the user shall be held liable for any and all damage
% arising from a violation of these points.

domain: volume.at
registrar: Domainers Registrar GmbH ( https://nic.at/registrar/668 )
registrant: VMVG11839175-NICAT
tech-c: VMVG11839175-NICAT
nserver: ns1.domainers.de
nserver: ns2.domainers.de
nserver: ns3.domainers.de
nserver: ns4.domainers.de
changed: 20190220 20:54:31
source: AT-DOM

personname: Michael Ledl
organization: Volume Media Verlags GmbH
street address: Universitaetsstrasse 4/5
postal code: 1090
city: Wien
country: Austria
phone: +431961074814
e-mail: Login to show email
VMVG11839175-NICAT
changed: 20180412 13:32:34
source: AT-DOM

Websites with Similar Names

Volum-7.com
Volum 7 Disseny, S.L.
Volum-bust.com
Deze domeinnaam is gereserveerd - Flexwebhosting
Volum.info
volum.info - For Sale!
Volum.io
Volum | Volum
Volum8.co
Home - Volum8 Creative, Inc.
Volumage.com
Welcome to VOLUMAGE.COM
Volumaileasy.com
volumaileasy.com is available for purchase - Sedo.com
Volumaitrise.com
Just a moment...

Recently Updated Websites

Winsoftware24.de (1 second ago.)Gentlemensward.com (3 seconds ago.)Aura-london.com (5 seconds ago.)Prospecttechlabs.com (6 seconds ago.)Notedistile.org (6 seconds ago.)Strong-encryption.com (8 seconds ago.)Gaveloftet.no (8 seconds ago.)Magen-darm-grippe.info (9 seconds ago.)Havenacupuncture.com (9 seconds ago.)Opescapitalgroup.com (10 seconds ago.)Timhortons.cc (11 seconds ago.)Paulschieldtcb.com (12 seconds ago.)Basakmetalurji.com.tr (12 seconds ago.)Pray.city (12 seconds ago.)Christonthecrapper.com (13 seconds ago.)Rleinformatica.com (14 seconds ago.)Architecturaldetail.net (17 seconds ago.)Bqik.net (17 seconds ago.)Stbfoerster.com (17 seconds ago.)Foborentals.com (17 seconds ago.)Promogramme.com (18 seconds ago.)Icestinataledellacasa.com (24 seconds ago.)Cootransrio.online (26 seconds ago.)Basecarnp.com (27 seconds ago.)Deserttobeaches.com (31 seconds ago.)Passarela.net (32 seconds ago.)Epitoanyag-online.hu (33 seconds ago.)Beef-ager.info (35 seconds ago.)Ludwig-zwei-forschung.de (35 seconds ago.)Brandjuice.studio (37 seconds ago.)

Recently Searched Keywords

newsmax (1 second ago.)help page (1 second ago.)protecting your privacy (1 second ago.)cost management (2 seconds ago.)etpbbuttonhover letter-spacing0px (6 seconds ago.)画廊 (6 seconds ago.)(secret link) (7 seconds ago.)lifelike sex doll (8 seconds ago.)hawk helmets replacement parts (11 seconds ago.)sales comm.module (12 seconds ago.)181 1 (12 seconds ago.)true isfitwidth true (13 seconds ago.)statementratio100optionpersuasive (14 seconds ago.)marka danışmanı (15 seconds ago.)lichess (15 seconds ago.)rarr liubomyrkuzmiak 0 (15 seconds ago.)高考英语习题精选--阅读理解 (16 seconds ago.)도장을 찍어주세요 (17 seconds ago.)xamarin forms datepicker (20 seconds ago.)觅友 (21 seconds ago.)imagine injection at the goodguys 22nd speedway motors southwest nationals (24 seconds ago.)leonardo da (26 seconds ago.)school house (27 seconds ago.)保价服务 (28 seconds ago.)fmcsa clearinghouse registration guide (29 seconds ago.)sap business one (29 seconds ago.)tips membeli lampu led langsung dari supplier (30 seconds ago.)gp75 leopard (32 seconds ago.)newandused (33 seconds ago.)hartford ct (35 seconds ago.)