Vorpommern-mv.info

Website Thumbnail
Checking...
https://www.vorpommern-mv.de - Home

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-07-15
Category: This site has not been categorized yet

Ausflugsziele und Sehenswürdigkeiten von der Ostsee bis in den Süden


Domain summary

Domain label
vorpommern-mv
Domain extension
info
Domain registered:
2020-08-03
Domain updated:
2020-07-15
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is vorpommern-mv.info ranked relative to other sites:

Percentage of visits to vorpommern-mv.info from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Vorpommern-mv.info registered?
A: Vorpommern-mv.info was registered 3 months, 4 weeks, 2 days, 21 hours, 19 minutes, 49 seconds ago on Monday, August 3, 2020.
Q: When was the WHOIS for Vorpommern-mv.info last updated?
A: The WHOIS entry was last updated 4 months, 2 weeks, 4 days, 21 hours, 19 minutes, 49 seconds ago on Wednesday, July 15, 2020.
Q: What are Vorpommern-mv.info's nameservers?
A: DNS for Vorpommern-mv.info is provided by the following nameservers:
  • dns01-tld.t-online.de
  • dns02-tld.t-online.de
Q: Who is the registrar for the Vorpommern-mv.info domain?
A: The domain has been registered at Afilias Global Registry Services.
Q: What is the traffic rank for Vorpommern-mv.info?
A: Vorpommern-mv.info has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Vorpommern-mv.info each day?
A: Vorpommern-mv.info receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Vorpommern-mv.info resolve to?
A: Vorpommern-mv.info resolves to the IPv4 address 80.150.6.143.
Q: In what country are Vorpommern-mv.info servers located in?
A: Vorpommern-mv.info has servers located in the Germany.
Q: What webserver software does Vorpommern-mv.info use?
A: Vorpommern-mv.info is powered by CM4all Webserver webserver.
Q: Who hosts Vorpommern-mv.info?
A: Vorpommern-mv.info is hosted by The Globaltap Corporation in North Rhine-westphalia, Düsseldorf, Germany, 40474.
Q: How much is Vorpommern-mv.info worth?
A: Vorpommern-mv.info has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Vorpommern-mv.info Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Vorpommern-mv.info Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Vorpommern-mv.info

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

12 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

3:
  1. //HTO01FLQAGBU-fix4this.homepagedesigner-hosting.de/;focus=TKOMSI_cm4all_com_widgets_Embed_22321131&frame=TKOMSI_cm4all_com_widgets_Embed_22321131
    //HTO01FLQAGBU-fix4this.homepagedesigner-hosting.de/;focus=TKOMSI_cm4all_com_widgets_Embed_22321131&frame=TKOMSI_cm4all_com_widgets_Embed_22321131
  2. //HTO01FLQAGBU-fix4this.homepagedesigner-hosting.de/;focus=TKOMSI_cm4all_com_widgets_Embed_22321017&frame=TKOMSI_cm4all_com_widgets_Embed_22321017
    //HTO01FLQAGBU-fix4this.homepagedesigner-hosting.de/;focus=TKOMSI_cm4all_com_widgets_Embed_22321017&frame=TKOMSI_cm4all_com_widgets_Embed_22321017
  3. //HTO01FLQAGBU-fix4this.homepagedesigner-hosting.de/;focus=TKOMSI_cm4all_com_widgets_Embed_22321151&frame=TKOMSI_cm4all_com_widgets_Embed_22321151
    //HTO01FLQAGBU-fix4this.homepagedesigner-hosting.de/;focus=TKOMSI_cm4all_com_widgets_Embed_22321151&frame=TKOMSI_cm4all_com_widgets_Embed_22321151

Links - Outbound (nofollow)

0:

Keyword Cloud for Vorpommern-mv.info

see 1056810534 jqueryidwiidcssmaxwidththiswidththisscript var iframewindowbengenvscope match2 varslideshowmatch match1xftiiframesetattributenamefunction var wiidwindowbengenvscopeahost windowbengenvscope match2regexp09 vararrayprototypeslicecalldocumentqueryselectorallscriptpop ifjqueryattrsrc srcloadfunction seeif windowbengenvscope variframematch1 windowbengenvscopenew windowcm4allxframetunnelinitiatoriframe xftiopenahrefwindowbengenvscope match2match reexecahost ifthisscript documentcurrentscript arrayprototypeslicecalldocumentqueryselectorallscriptpopnone iframestyledisplaybackgroundrepeatwindowbengenvscope var reiframesetattributeiddocumentcreateelementiframe iframesetattributeallowtransparency truematch match1 windowbengenvscopedocumentcurrentscript arrayprototypeslicecalldocumentqueryselectorallscriptpopvar src jqueryurophotoouterthisscriptififramestyleborder none iframestyledisplaywindowbengenvscope varbackgroundcolor backgroundrepeat norepeatiframestyleheight100 iframestylebackgroundcolor transparentiframestyledisplay block iframeclasslistadduntrustedwidgetframesrcloadfunction seeahost windowbengenvscoperegexp09 var matchif windowiframesuffix windowiframesuffixiframeclasslistadduntrustedwidgetframe thisscriptinsertadjacentelementafterendblockwindowiframesuffix new dategettimevar matchnorepeat8siframestylebackgroundcolor transparentreexecahost iftruewindowiframesuffix windowiframesuffixfunctionbackgroundrepeat norepeatwindowiframesuffixif windowiframesuffixkeyvisualelement2dategettime ifvar thisscriptdocumentcreateelementiframewindowiframesuffix newwindowiframesuffix iframesetattributenameseewindowiframesuffix windowiframesuffix newjqueryattrsrcwiid imgattrsrc jqueryattrsrcbackgroundcolorsrcwindowbengenvscope ahost windowbengenvscopeiframe documentcreateelementiframeiframe varwindowcm4allxframetunnelinitiatoriframeiframestyleborderdocumentcurrentscriptiframestylewidth100possrc jqueryurophotoouterarrayprototypeslicecalldocumentqueryselectorallscriptpop if windowiframesuffixmatch2 var xftiif match match1var thisscript documentcurrentscriptkvwindowiframesuffix iframestylewidth100srcloadfunctionthisscript documentcurrentscriptfunction var thisscriptsee 1056810534hrefblock iframeclasslistadduntrustedwidgetframe thisscriptinsertadjacentelementafterendxfti new windowcm4allxframetunnelinitiatoriframejqueryurophotoouter wiid imgattrsrcvar xftireexecahostmatch2 varwindowiframesuffix iframestylewidth100 iframestyleheight100regexp09new dategettime0iframestylebackgroundcolorsrc jqueryurophotoouter wiidmatch1056810534 jqueryidwiidcssmaxwidththiswidthiframesetattributeallowtransparency true iframesetattributeidmatch1match1 windowbengenvscope ahostdategettime if thisscript1falseiframestylebackgroundcolor transparent iframestyleborderjqueryidwiidcssmaxwidththiswidthxfti newif slideshownone iframestyledisplay blockiframestyledisplayiframestyledisplay blockvar retrue iframesetattributeidiframe documentcreateelementiframe iframesetattributeallowtransparencywindowcm4allxframetunnelinitiatoriframe xftiopenahrefblock iframeclasslistadduntrustedwidgetframeif matchtransparentnew regexp09srcloadfunction see 1056810534backgroundcolor backgroundrepeatiframeclasslistadduntrustedwidgetframe thisscriptinsertadjacentelementafterend iframeimgattrsrciframestyleheight100imgattrsrc jqueryattrsrc srcloadfunctiondategettimeopacityvar match reexecahostvar iframeif thisscriptthisscriptinsertadjacentelementafterendre newxftiopenahrefjqueryurophotoouterfunction vararrayprototypeslicecalldocumentqueryselectorallscriptpopiframestyleborder nonereturniframeclasslistadduntrustedwidgetframeahosttransparent iframestyleborder nonewiidiframestyleheight100 iframestylebackgroundcolorif thisscript varvar srcre new regexp09var re newiframesetattributeallowtransparency truemsiethisscriptinsertadjacentelementafterend iframe varthisscriptinsertadjacentelementafterend iframeiframestylewidth100 iframestyleheight100 iframestylebackgroundcolordocumentcreateelementiframe iframesetattributeallowtransparencyrevar xfti newiframesetattributeallowtransparencyopacity 8snew windowcm4allxframetunnelinitiatoriframewindowbengenvscope ahostthisscript varmatch reexecahostdocumentcurrentscript arrayprototypeslicecalldocumentqueryselectorallscriptpop ifjqueryurophotoouter wiidwiid imgattrsrcnewnonereexecahost if matchimgattrsrc jqueryattrsrcmatch2jqueryattrsrc srcloadfunctionvar wiidif windowbengenvscopetransparent iframestylebordernew regexp09 varvarvar iframe documentcreateelementiframeiframestylewidth100 iframestyleheight100new dategettime if

Longtail Keyword Density for Vorpommern-mv.info

KeywordsOccurences
function var wiid6
var src jqueryurophotoouter6
src jqueryurophotoouter wiid6
jqueryurophotoouter wiid imgattrsrc6
wiid imgattrsrc jqueryattrsrc6
imgattrsrc jqueryattrsrc srcloadfunction6
jqueryattrsrc srcloadfunction see6
srcloadfunction see 10568105346
see 1056810534 jqueryidwiidcssmax-widththiswidth6
background-color background-repeat no-repeat5
var thisscript documentcurrentscript3
reexecahost if match3
if windowbengenvscope var3
windowbengenvscope var re3
var re new3
re new regexp0-9-3
new regexp0-9- var3
regexp0-9- var match3
var match reexecahost3
match reexecahost if3
if match match13
iframeclasslistadduntrustedwidgetframe thisscriptinsertadjacentelementafterend iframe3
match match1 windowbengenvscope3
match1 windowbengenvscope ahost3
windowbengenvscope ahost windowbengenvscope3
ahost windowbengenvscope match23
windowbengenvscope match2 var3
match2 var xfti3
var xfti new3
xfti new windowcm4allxframetunnelinitiatoriframe3
new windowcm4allxframetunnelinitiatoriframe xftiopenahref3
thisscriptinsertadjacentelementafterend iframe var3
block iframeclasslistadduntrustedwidgetframe thisscriptinsertadjacentelementafterend3
thisscript documentcurrentscript arrayprototypeslicecalldocumentqueryselectorallscriptpop3
var iframe documentcreateelementiframe3
documentcurrentscript arrayprototypeslicecalldocumentqueryselectorallscriptpop if3
arrayprototypeslicecalldocumentqueryselectorallscriptpop if windowiframesuffix3
if windowiframesuffix windowiframesuffix3
windowiframesuffix windowiframesuffix new3
windowiframesuffix new dategettime3
new dategettime if3
dategettime if thisscript3
if thisscript var3
thisscript var iframe3
iframe documentcreateelementiframe iframesetattributeallowtransparency3
iframestyledisplay block iframeclasslistadduntrustedwidgetframe3
documentcreateelementiframe iframesetattributeallowtransparency true3
iframesetattributeallowtransparency true iframesetattributeid3
windowiframesuffix iframestylewidth100 iframestyleheight1003
iframestylewidth100 iframestyleheight100 iframestylebackgroundcolor3
iframestyleheight100 iframestylebackgroundcolor transparent3
function var thisscript3
transparent iframestyleborder none3
iframestyleborder none iframestyledisplay3
none iframestyledisplay block3
iframestylebackgroundcolor transparent iframestyleborder3
function var10
var wiid6
var src6
src jqueryurophotoouter6
jqueryurophotoouter wiid6
wiid imgattrsrc6
imgattrsrc jqueryattrsrc6
jqueryattrsrc srcloadfunction6
srcloadfunction see6
see 10568105346
1056810534 jqueryidwiidcssmax-widththiswidth6
background-color background-repeat5
background-repeat no-repeat5
opacity 8s4
reexecahost if3
iframe var3
if windowbengenvscope3
windowbengenvscope var3
var re3
re new3
new regexp0-9-3
regexp0-9- var3
var match3
match reexecahost3
match2 var3
if match3
match match13
match1 windowbengenvscope3
windowbengenvscope ahost3
ahost windowbengenvscope3
windowbengenvscope match23
iframeclasslistadduntrustedwidgetframe thisscriptinsertadjacentelementafterend3
var xfti3
xfti new3
new windowcm4allxframetunnelinitiatoriframe3
windowcm4allxframetunnelinitiatoriframe xftiopenahref3
thisscriptinsertadjacentelementafterend iframe3
iframestylebackgroundcolor transparent3
block iframeclasslistadduntrustedwidgetframe3
thisscript var3
var thisscript3
thisscript documentcurrentscript3
documentcurrentscript arrayprototypeslicecalldocumentqueryselectorallscriptpop3
arrayprototypeslicecalldocumentqueryselectorallscriptpop if3
if windowiframesuffix3
windowiframesuffix windowiframesuffix3
windowiframesuffix new3
new dategettime3
dategettime if3
if thisscript3
var iframe3
iframestyledisplay block3
iframe documentcreateelementiframe3
documentcreateelementiframe iframesetattributeallowtransparency3
iframesetattributeallowtransparency true3
true iframesetattributeid3
windowiframesuffix iframesetattributename3
windowiframesuffix iframestylewidth1003
iframestylewidth100 iframestyleheight1003
iframestyleheight100 iframestylebackgroundcolor3
transparent iframestyleborder3
iframestyleborder none3
none iframestyledisplay3
if slideshow3
var46
if26
function14
windowiframesuffix12
wiid12
new11
windowbengenvscope9
07
jqueryattrsrc6
match6
iframe6
thisscript6
16
see6
srcloadfunction6
jqueryidwiidcssmax-widththiswidth6
imgattrsrc6
src6
false6
jqueryurophotoouter6
no-repeat5
opacity5
background-repeat5
background-color5
return4
true4
8s4
pos3
href3
slideshow3
xftiopenahref3
windowcm4allxframetunnelinitiatoriframe3
xfti3
match23
ahost3
match13
reexecahost3
kv3
regexp0-9-3
re3
iframesetattributename3
thisscriptinsertadjacentelementafterend3
iframesetattributeid3
msie3
23
documentcurrentscript3
arrayprototypeslicecalldocumentqueryselectorallscriptpop3
dategettime3
documentcreateelementiframe3
iframesetattributeallowtransparency3
iframestylewidth1003
iframeclasslistadduntrustedwidgetframe3
iframestyleheight1003
iframestylebackgroundcolor3
transparent3
iframestyleborder3
none3
iframestyledisplay3
block3
keyvisualelement3

Who hosts Vorpommern-mv.info?

Vorpommern-mv.info Hosting Provider Information

Hosted IP Address:80.150.6.143
Hosted Hostname:tld.t-online.de
Service Provider:The Globaltap Corporation
Hosted Country:GermanyDE
Location Latitude:51.2674
Location Longitude:6.7442
Webserver Software:CM4all Webserver

Is "The Globaltap Corporation" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
The Globaltap Corporation
0.0095%

HTTP Header Analysis for Vorpommern-mv.info

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
transfer-encoding: chunked
cache-control: no-store
content-type: text/html; charset=utf-8
date: Wed, 15 Jul 2020 07:40:33 GMT
p3p: CP="CAO PSA OUR"
server: CM4all Webserver

Vorpommern-mv.info Domain Nameserver Information

HostIP AddressCountry
dns01-tld.t-online.de 212.185.250.107
dns02-tld.t-online.de 217.237.160.27


Need to find out who hosts Vorpommern-mv.info?


Domain Registration (WhoIs) information for Vorpommern-mv.info

 Domain Name: VORPOMMERN-MV.INFO
Registry Domain ID: D503300001183476933-LRMS
Registrar WHOIS Server: whois.registrar.telekom.de
Registrar URL: http://www.registrar.telekom.de
Updated Date:
Creation Date: 2020-03-08T18:02:35Z
Registry Expiry Date: 2021-03-08T18:02:35Z
Registrar Registration Expiration Date:
Registrar: Deutsche Telekom AG
Registrar IANA ID: 226
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.70003307345
Reseller:
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Registrant Organization:
Registrant State/Province:
Registrant Country: DE
Name Server: DNS01-TLD.T-ONLINE.DE
Name Server: DNS02-TLD.T-ONLINE.DE
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form is https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-04-08T18:59:46Z

Websites with Similar Names

Vorpommern-mv.info
https://www.vorpommern-mv.de - Home
Vorpommern.shop
Domain im Kundenauftrag registriert
Vorpommersche-landesbuehne.de
Vorpommersche Landesbühne ~ Hand auf's Herz!
Vorpost.ru
ФОРПОСТ - Источники бесперебойного питания ИБЭП Форпост. ИБП, инверторы, UPS.
Vorpostnsk.com
VORPOSTNSK.COM

Recently Updated Websites

Piriyevtrust.com (1 second ago.)Potsbudgeter.com (4 seconds ago.)Persianconversation.com (6 seconds ago.)Qapschool.com (7 seconds ago.)Receptenpapa.com (8 seconds ago.)Pr18vip.com (8 seconds ago.)Querenciavirtual.com (10 seconds ago.)Rashtreey24news.com (10 seconds ago.)Pauyuentongbalm.com (11 seconds ago.)Starkexcavationandlandscapedesign.com (12 seconds ago.)Potdiv.com (12 seconds ago.)Psalmshop.com (13 seconds ago.)Sugarbabybath.com (14 seconds ago.)Ovzii.com (15 seconds ago.)Redzoneengineering.com (15 seconds ago.)Nehruplaceoffice.com (16 seconds ago.)Realtalkbro.com (16 seconds ago.)Pompidou-art.com (17 seconds ago.)Randomeyecharts.com (17 seconds ago.)Pizzabadabing.com (18 seconds ago.)Siliconlagoons.com (20 seconds ago.)Restaurantealmita.com (21 seconds ago.)Snappysmoothies.com (21 seconds ago.)Pmshield.com (23 seconds ago.)Paratusbas.com (24 seconds ago.)Redeemyourcoupon.com (25 seconds ago.)Powrfox.com (25 seconds ago.)Qk969.com (26 seconds ago.)Sneeperdoodles.com (26 seconds ago.)Rainyyy.com (26 seconds ago.)

Recently Searched Keywords

akhir (1 second ago.)informasi (1 second ago.)pokoi 3 pokojecena (2 seconds ago.)hundemarken (3 seconds ago.)health amp (7 seconds ago.)geschenktipps (7 seconds ago.)gerätekennzeichnung (11 seconds ago.)slow moving (14 seconds ago.)nhn (14 seconds ago.)geburtstagsgeschenk (16 seconds ago.)new york city weather (22 seconds ago.)rotable (28 seconds ago.)whatever (34 seconds ago.)carbon (46 seconds ago.)color-4 (49 seconds ago.)parts (50 seconds ago.)evernote (58 seconds ago.)spaces (1 minute 1 second ago.)kirjaudu sisään (1 minute 8 seconds ago.)行业动态 (1 minute 9 seconds ago.)ленинск-кузнецкий (1 minute 15 seconds ago.)quick order (1 minute 36 seconds ago.)dealers (1 minute 37 seconds ago.)david-added (1 minute 40 seconds ago.)social-icons-size-largesocial-icons-style-regular (1 minute 50 seconds ago.)aid (1 minute 51 seconds ago.)release (1 minute 52 seconds ago.)dobry dobry bardzo dobry dobry dobry dobry dobry dobry bardzo dobry (2 minutes 4 seconds ago.)warszawa (2 minutes 10 seconds ago.)both the web (2 minutes 10 seconds ago.)