VSCO

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

VSCO is a creative channel. We build creative tools, spaces, and connections driven by self-expression.



Domain summary

Last updated
2021-03-26
Domain label
vsco
Domain extension
company
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Vsco.company registered?
A: Vsco.company was registered 8 months, 1 week, 3 days, 8 hours, 29 minutes, 41 seconds ago on Friday, March 26, 2021.
Q: When was the WHOIS for Vsco.company last updated?
A: The WHOIS entry was last updated 8 months, 1 week, 3 days, 8 hours, 29 minutes, 41 seconds ago on Friday, March 26, 2021.
Q: What are Vsco.company's nameservers?
A: DNS for Vsco.company is provided by the following nameservers:
  • ns7.markmonitor.com
  • ns6.markmonitor.com
  • ns5.markmonitor.com
  • ns4.markmonitor.com
  • ns3.markmonitor.com
  • ns2.markmonitor.com
  • ns1.markmonitor.com
Q: Who is the registrar for the Vsco.company domain?
A: The domain has been registered at .
Q: What is the traffic rank for Vsco.company?
A: Vsco.company has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Vsco.company each day?
A: Vsco.company receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Vsco.company resolve to?
A: Vsco.company resolves to the IPv4 address 72.52.10.14.
Q: In what country are Vsco.company servers located in?
A: Vsco.company has servers located in the United States.
Q: What webserver software does Vsco.company use?
A: Vsco.company is powered by Envoy webserver.
Q: Who hosts Vsco.company?
A: Vsco.company is hosted by Akamai Technologies, Inc. in United States.
Q: How much is Vsco.company worth?
A: Vsco.company has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Vsco.company Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Vsco.company Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Vsco.company

H1 Headings

1 :
  1. Make it Anyway.Make it with VSCO.

H2 Headings

2 :
  1. Creative tools, inspiration, and a place for you to be you.
  2. Become a member

H3 Headings

5 :
  1. Tools Create
  2. Discover Discover
  3. Feed Connect
  4. VSCO
  5. VSCO Membership

H4 Headings

11 :
  1. Free
  2. Basic VSCO Presets
  3. Standard Editing Tools
  4. Content in Discover
  5. Monthly or Annual Subscription
  6. 200+ VSCO Presets
  7. Advanced Photo Editing Tools
  8. Video Editing Tools
  9. Montage
  10. Weekly Photo Challenges
  11. Bonus Content for Members

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-23285656-1

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Vsco.company

0 01 0msflex1 1norepeatwebkitbackgroundsize20px autobackgroundsize20px0msflex112media1pxgothicapplesystemblinkmacsystemfontsegoe uihelveticaarialsansserifapple13color050 norepeatwebkitbackgroundsize20px2video0media50 norepeatwebkitbackgroundsize20px autobackgroundsize20px0flex11 0msflex1uihelveticaarialsansserifapple colorui emojisegoe ui5emojisegoe uigothicapplesystemblinkmacsystemfontsegoe uihelveticaarialsansserifapple coloruihelveticaarialsansserifappleminwidth11 12mediacolor emojisegoe1 0flex1 1autobackgroundsize20pxmaxwidthcolor emojisegoe uiediting460flex1 1702sui emojisegoe0media minwidthnorepeatwebkitbackgroundsize20px11 12media minwidthuihelveticaarialsansserifapple color emojisegoegothicapplesystemblinkmacsystemfontsegoeemojisegoevscoyour0msflex1 1 0flex1emojisegoe ui emojisegoe0 50 norepeatwebkitbackgroundsize20pxexclusive0msflex1 1autoflex1autoautomsflex1ui12media minwidth1 0flex1photo0 50tools

Longtail Keyword Density for Vsco.company

KeywordsOccurences
gothic-apple-systemblinkmacsystemfontsegoe uihelveticaarialsans-serifapple color23
uihelveticaarialsans-serifapple color emojisegoe23
color emojisegoe ui23
emojisegoe ui emojisegoe23
ui emojisegoe ui23
1 0-ms-flex1 16
0-ms-flex1 1 0flex16
1 0flex1 16
11 12media min-width4
0 50 no-repeat-webkit-background-size20px3
50 no-repeat-webkit-background-size20px autobackground-size20px3
emojisegoe ui46
gothic-apple-systemblinkmacsystemfontsegoe uihelveticaarialsans-serifapple23
uihelveticaarialsans-serifapple color23
color emojisegoe23
ui emojisegoe23
0 09
1 0-ms-flex16
0-ms-flex1 16
1 0flex16
0flex1 16
0media min-width5
0 504
11 12media4
12media min-width4
50 no-repeat-webkit-background-size20px3
no-repeat-webkit-background-size20px autobackground-size20px3
min-width72
emojisegoe46
ui46
042
132
uihelveticaarialsans-serifapple23
gothic-apple-systemblinkmacsystemfontsegoe23
color23
210
max-width8
your7
0-ms-flex16
0flex16
vsco5
35
0media5
tools5
45
55
editing4
12media4
photo4
64
74
02s4
autobackground-size20px3
no-repeat-webkit-background-size20px3
1px3
video3
autoflex13
exclusive3
auto-ms-flex13
auto3

Who hosts Vsco.company?

Vsco.company Hosting Provider Information

Hosted IP Address:72.52.10.14
Hosted Hostname:a72-52-10-14.deploy.static.akamaitechnologies
Service Provider:Akamai Technologies, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:envoy

Is "Akamai Technologies, Inc." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
Akamai Technologies, Inc.
0.1111%

HTTP Header Analysis for Vsco.company

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
cache-control: max-age=0, no-cache
content-type: text/html; charset=utf-8
etag: W/"34e62-8 5oAZ1Cd 463n4bzgjYYMm0Dcc"
vary: Accept-Encoding
content-encoding: gzip
date: Fri, 26 Mar 2021 22:29:16 GMT
x-envoy-upstream-service-time: 11
server: envoy
content-security-policy: frame-src https://*.doubleclick.net:* https://*.facebook.com:* https://*.google.com:* https://*.soundcloud.com:* https://*.spotify.com:* https://*.twitter.com:* https://*.vimeo.com:* https://*.youtube.com:*; frame-ancestors 'self';
x-forwarded-host: https://vsco.co
strict-transport-security: max-age=31536000; includeSubDomains
transfer-encoding: chunked

Vsco.company Domain Nameserver Information

HostIP AddressCountry
ns7.markmonitor.com 192.174.68.4
ns6.markmonitor.com 176.97.158.3
ns5.markmonitor.com 192.174.68.3
ns4.markmonitor.com 176.97.158.2
ns3.markmonitor.com 192.174.68.2
ns2.markmonitor.com 176.97.158.1
ns1.markmonitor.com 192.174.68.1


Need to find out who hosts Vsco.company?


Domain Registration (WhoIs) information for Vsco.company

 Domain Name: vsco.company
Registry Domain ID: 4aca5e9858204f89885050d90b0ff2ca-DONUTS
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: http://www.markmonitor.com
Updated Date: 2021-03-06T14:57:15Z
Creation Date: 2017-12-05T20:29:57Z
Registry Expiry Date: 2022-12-05T20:29:57Z
Registrar: MarkMonitor Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2083895740
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: DNStination Inc.
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: CA
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: US
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns1.markmonitor.com
Name Server: ns3.markmonitor.com
Name Server: ns4.markmonitor.com
Name Server: ns2.markmonitor.com
Name Server: ns6.markmonitor.com
Name Server: ns5.markmonitor.com
Name Server: ns7.markmonitor.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-03-26T22:29:18Z

Websites with Similar Names

Vsco-girls.shop
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
Vsco-shop.com
Web Server's Default Page
Vsco.camera
Gallery | yuryh | VSCO
Vsco.fashion
vsco.fashion - Registered at Namecheap.com

Recently Updated Websites

Yeverwerei.fun (3 seconds ago.)Hapicigru.com (6 seconds ago.)Vesselyard.com (6 seconds ago.)Beanopenerofdoors.com (10 seconds ago.)Nbzdwl.com (12 seconds ago.)Thegratefulmindset.com (13 seconds ago.)1080pxnxx.com (14 seconds ago.)Cannabistourbc.com (14 seconds ago.)Tenorshare.fr (17 seconds ago.)Jsmuguruza.com (18 seconds ago.)Legendbricks.com (21 seconds ago.)Rajivmovva.com (24 seconds ago.)Admdiri.com (25 seconds ago.)Aplusstoragecarsonville.com (25 seconds ago.)Mp3craft.ru (27 seconds ago.)Timelessveterinaryinternational.com (27 seconds ago.)Tevama.qa (29 seconds ago.)Openstore.ch (31 seconds ago.)Morning.social (32 seconds ago.)Sdguoli.com (33 seconds ago.)Thesageevolution.com (34 seconds ago.)Kyped.com (35 seconds ago.)Zzzz.su (36 seconds ago.)Bircocukbirumut.com (37 seconds ago.)Theyoungporn.net (37 seconds ago.)Westerross.org (40 seconds ago.)Modirsun.com (41 seconds ago.)Extremadura.net (42 seconds ago.)Futureimpact.net (44 seconds ago.)Magicnet.net (46 seconds ago.)

Recently Searched Keywords

moart 21 mai (2 seconds ago.)domeky (3 seconds ago.)sel fmbtnbackground-imagenonefmmnav (7 seconds ago.)hemen arayn (8 seconds ago.)registrarte (9 seconds ago.)0 محصول (10 seconds ago.)lake como real (10 seconds ago.)japanese massage porn (11 seconds ago.)loop false slidesperview (11 seconds ago.)studio a (11 seconds ago.)downloadbereich (13 seconds ago.)clipper accessories (13 seconds ago.)nov 2021 (14 seconds ago.)renovationsresidential amp commercial (15 seconds ago.)«ezkurdia nire aldamenean izatea eskertzekoa da» (15 seconds ago.)«ezkurdia nire aldamenean izatea eskertzekoa da» (15 seconds ago.)aspepelota campeonatos (16 seconds ago.)runner-up (16 seconds ago.)同城外卖平台 (17 seconds ago.)spring motorcycle riding (18 seconds ago.)arene arknights (18 seconds ago.)詳細情報を見る (19 seconds ago.)nude1.eu (19 seconds ago.)often meaning in malayalam (20 seconds ago.)azkoitia romperá el primer empate (20 seconds ago.)倭ヒナ (20 seconds ago.)simple wearing style (20 seconds ago.)ataca sufre (21 seconds ago.)twitter 1464557135564582913 (21 seconds ago.)ataca sufre (22 seconds ago.)