Wa.gov

Website Thumbnail
Checking...
Access Washington Home

Safety: High trust score
Year Founded: 2020
Global Traffic Rank: 996
Estimated Worth: $16,221,600
Last updated:2020-11-07


Domain summary

Domain label
wa
Domain extension
gov
Global Traffic Rank
996
Statvoo Rating
A
Trust Score
High trust score
Estimated worth
$16,221,600
Estimated daily income
$15,020
Estimated monthly income
$456,858

Rank summary

How is wa.gov ranked relative to other sites:

Percentage of visits to wa.gov from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Wa.gov registered?
A: Wa.gov was registered 3 weeks, 5 days, 22 hours, 49 minutes, 9 seconds ago on Saturday, November 7, 2020.
Q: When was the WHOIS for Wa.gov last updated?
A: The WHOIS entry was last updated 3 weeks, 5 days, 22 hours, 49 minutes, 9 seconds ago on Saturday, November 7, 2020.
Q: What are Wa.gov's nameservers?
A: DNS for Wa.gov is provided by the following nameservers:
  • puma.state.or.us
  • lion.state.or.us
  • nsoly1.wa.gov
  • nsspo1.wa.gov
Q: Who is the registrar for the Wa.gov domain?
A: The domain has been registered at .
Q: What is the traffic rank for Wa.gov?
A: Wa.gov ranks 996 globally on Alexa. Wa.gov has a High trust score, and a Statvoo Rank of A.
Q: How many people visit Wa.gov each day?
A: Wa.gov receives approximately 1,877,510 visitors and 15,020,080 page impressions per day.
Q: What IP address does Wa.gov resolve to?
A: Wa.gov resolves to the IPv4 address 23.185.0.3.
Q: In what country are Wa.gov servers located in?
A: Wa.gov has servers located in the United States.
Q: What webserver software does Wa.gov use?
A: Wa.gov is powered by Nginx webserver.
Q: Who hosts Wa.gov?
A: Wa.gov is hosted by OJSC Vimpelcom in United States.
Q: How much is Wa.gov worth?
A: Wa.gov has an estimated worth of $16,221,600. An average daily income of approximately $15,020, which is roughly $456,858 per month.

Wa.gov Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Wa.gov Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Wa.gov

H1 Headings

0 :

H2 Headings

8 :
  1. Explore Topics
  2. Services
  3. News & Media
  4. Government Agencies
  5. Contact Us
  6. Just for You
  7. How Do I
  8. Popular Online Services

H3 Headings

22 :
  1. Most Popular
  2.  
  3.  
  4. Latest News Headlines
  5. Featured Videos
  6. Latest from the Washington Channel
  7. State of Washington Facebook Pages
  8. State of Washington Twitter Feeds
  9. State of Washington Flickr Pages
  10. State of Washington Blog Sites
  11. State of Washington RSS Feeds
  12. State Government
  13. Tribal Government
  14. United States Government
  15. Governor's Office
  16. State Government
  17. Elected Officials
  18. Have Questions?
  19. About Washington
  20. Alerts
  21. Quick Links
  22. About This Site

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

12 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-25888199-1

Links - Internal

137:
  1. http://wa.gov/index.html
    http://wa.gov/index.html
  2. Wa Text Size
    http://wa.gov/siteinformation/changetextsize.html
  3. Wa Explore Topics
    http://wa.gov/topics.html
  4. Wa Community Services
    http://wa.gov/topics/communityservices/index.html
  5. Wa Community Technology
    http://wa.gov/topics/communitytechnology/index.html
  6. Wa Consumer Protection
    http://wa.gov/topics/consumerprotection/index.html
  7. Wa Doing Business
    http://wa.gov/topics/business/index.html
  8. Wa Education
    http://wa.gov/topics/education/index.html
  9. Wa Emergency Information and Resources
    http://wa.gov/topics/emergency/index.html
  10. Wa Employment
    http://wa.gov/topics/employment/index.html
  11. Wa Environment
    http://wa.gov/topics/environment/index.html
  12. Wa Government
    http://wa.gov/topics/government/index.html
  13. Wa Laws and Rules
    http://wa.gov/topics/statelaws/index.html
  14. Wa Licenses and Certificates
    http://wa.gov/topics/licensecertificate/index.html
  15. Wa Living
    http://wa.gov/topics/living/index.html
  16. Wa Mobile Apps
    http://wa.gov/topics/mobile%20applications/index.html
  17. Wa Open Data
    http://wa.gov/topics/opendata/index.html
  18. Wa Personal Documents
    http://wa.gov/topics/personaldocuments/index.html
  19. Wa Public Health
    http://wa.gov/topics/publichealth/index.html
  20. Wa Public Safety
    http://wa.gov/topics/publicsafety/index.html
  21. Wa State Facts
    http://wa.gov/topics/statefacts/index.html
  22. Wa Transportation
    http://wa.gov/topics/transportation/index.html
  23. Wa Visiting and Recreation
    http://wa.gov/topics/visiting/index.html
  24. Wa Voting and Elections
    http://wa.gov/topics/voting/index.html
  25. Wa Services
    http://wa.gov/services.html
  26. Wa Renew Drivers License
    http://www.dol.wa.gov/driverslicense/renew.html
  27. Wa Vehicle and Boat Registration
    http://www.dol.wa.gov/vehicleregistration/?homeboxmore
  28. Wa Hunting or Fishing License
    https://fishhunt.dfw.wa.gov/
  29. Wa Business License Application
    https://dor.wa.gov/open-business/apply-business-license
  30. Wa Directory Assistance
    http://cts.wa.gov/products/Communications/DirectoryAssistance.aspx
  31. Wa Lookup Sales Tax Rates
    https://dor.wa.gov/find-taxes-rates/sales-and-use-tax-rates
  32. Wa File Business Taxes Online
    https://fortress.wa.gov/dor/efile/fortresslogon/
  33. Wa Lookup Business Information
    http://bls.dor.wa.gov/checkstatus.aspx
  34. Wa Report New Employee Hires
    https://www.dshs.wa.gov/esa/division-child-support/new-hire-reporting
  35. Wa File a Complaint
    http://wa.gov/topics/consumerprotection/filecomplaint.html
  36. Wa Apply for Unemployment
    https://esd.wa.gov/unemployment
  37. Wa Order Certified Copies of Vital Records
    http://www.doh.wa.gov/LicensesPermitsandCertificates/BirthDeathMarriageandDivorce.aspx
  38. Wa Paid Family and Medical Leave
    https://paidleave.wa.gov/
  39. Wa Charities Search
    https://www.sos.wa.gov/charities/
  40. Wa Pay Child Support Online
    https://secure.dshs.wa.gov/home/
  41. Wa Contractors - Register or Renew
    http://www.lni.wa.gov/TradesLicensing/Contractors/HowReg/default.asp
  42. Wa More Services...
    http://wa.gov/services.html
  43. Wa News & Media
    http://wa.gov/Media.html
  44. Wa This month's news...
    http://wa.gov/media/news/current
  45. Wa Last month's news...
    http://wa.gov/media/news/previous
  46. Wa Featured videos from Washington State agencies, boards and commissions.
    http://wa.gov/media/featured-videos/index.html
  47. http://wa.gov/media/YouTube.html
    http://wa.gov/media/YouTube.html
  48. Wa More State Channels
    http://wa.gov/media/YouTube.html
  49. Wa More State Facebook Pages
    http://wa.gov/media/facebook.html
  50. Wa More State Twitter Feeds
    http://wa.gov/media/twitter.html
  51. Wa More State Flickr Pages
    http://wa.gov/media/flickr.html
  52. Wa All Consuming - Attorney General
    http://www.atg.wa.gov/allconsuming.aspx
  53. Wa From Our Corner - Secretary of State
    http://blogs.secstate.wa.gov/FromOurCorner/
  54. Wa State Library - Secretary of State
    http://blogs.secstate.wa.gov/library/
  55. Wa More State Blog Sites
    http://wa.gov/media/blogs.html
  56. Wa Attorney General’s Office
    http://www.atg.wa.gov/RSS.aspx
  57. Wa Commerce, Dept. of
    http://www.commerce.wa.gov/rss/ited/ctedrss.xml
  58. Wa Ecology, Dept. of
    http://www.ecy.wa.gov/news/rss.xml
  59. Wa Fish and Wildlife, Dept. of
    http://wdfw.wa.gov/rss.html
  60. Wa Governor's Office
    http://www.governor.wa.gov/rss/GovRSS.xml
  61. Wa Health Care Authority
    http://www.hca.wa.gov/rss/news.xml
  62. Wa Labor & Industries, Dept. of
    http://www.lni.wa.gov/rss/newsreleases.xml
  63. Wa Legislature Bill Information
    http://www.leg.wa.gov/legislature/Pages/AboutLegRSS.aspx
  64. Wa Office of Financial Management
    http://www.accountability.wa.gov/rss/default.asp
  65. Wa More State RSS Feeds
    http://wa.gov/media/rss.html
  66. Wa Government Agencies
    http://wa.gov/governmentagencies.html
  67. Wa State Agencies, Boards and Commissions
    http://wa.gov/agency.html
  68. Wa State Legislature
    http://wa.gov/topics/government/state/legislature.html
  69. Wa Washington Courts
    http://www.courts.wa.gov/
  70. Wa Cities and Towns
    http://wa.gov/topics/business/City/Business/License.html
  71. Wa Washington State Tribal Directory
    http://www.goia.wa.gov/Tribal-Directory/TribalDirectory.pdf
  72. Wa Tribal Government Resources
    http://goia.wa.gov/
  73. Wa Military Facilities in Washington State
    http://wa.gov/topics/living/militaryfacilities.html
  74. Wa Contact Us
    http://wa.gov/contactgovernment.html
  75. Wa Governor's Website
    http://www.governor.wa.gov/
  76. Wa Contact the Governor
    http://www.governor.wa.gov/contact/
  77. Wa Governor's RSS Feed
    http://www.governor.wa.gov/rss/news
  78. Wa State Agencies
    http://wa.gov/agency.html
  79. Wa State Employee Directory
    https://contact.wa.gov/
  80. Wa Cities, Towns and Counties
    http://wa.gov/topics/government/local.html
  81. Wa Statewide Officials
    https://wei.sos.wa.gov/agency/osos/en/candidates_and_campaigns/Pages/elected_officials_2014.aspx
  82. Wa U.S. Congress
    https://wei.sos.wa.gov/agency/osos/en/candidates_and_campaigns/Pages/elected_officials_2014.aspx
  83. Wa Washington State Legislature
    https://app.leg.wa.gov/MemberEmail/Default.aspx
  84. http://wa.gov/contactgovernment/helpcenter.html
    http://wa.gov/contactgovernment/helpcenter.html
  85. Wa Coronavirus (COVID-19) outbreak
    https://coronavirus.wa.gov/
  86. Wa U.S. Census
    https://www.ofm.wa.gov/washington-data-research/population-demographics/decennial-census/2020-census-everyone-counts
  87. Wa Privacy Checklists
    http://privacy.wa.gov/privacy-checklists
  88. Wa Doing Business in Washington
    http://business.wa.gov/
  89. Wa Geospatial Portal
    http://geo.wa.gov/
  90. Wa State Data Portal
    https://data.wa.gov/
  91. Wa Current State Budgets
    http://fiscal.wa.gov/BudgetA.aspx
  92. Wa State Revenue Reports
    http://fiscal.wa.gov/Revenue.aspx
  93. Wa Emergency Resources
    http://wa.gov/topics/emergency.html
  94. Wa Disaster News
    http://www.emd.wa.gov/
  95. Wa Washington Emergency Management Division
    http://www.emd.wa.gov/
  96. Wa Arts and Culture
    http://wa.gov/topics/visiting/artsculture.html
  97. Wa Events and Festivals
    http://wa.gov/topics/visiting/festivals.html
  98. Wa Recreation and Activities
    http://wa.gov/topics/visiting/recreation.html
  99. Wa Residents
    http://wa.gov/topics.html
  100. Wa Business Owners
    http://business.wa.gov/
  101. Wa Visitors
    http://wa.gov/topics/visiting.html
  102. Wa Consumers
    http://wa.gov/topics/consumerprotection.html
  103. Wa State Government Employees
    http://wa.gov/topics/government/stateemployees.html
  104. Wa Get help finding a job
    http://wa.gov/topics/employment/getjob.html
  105. Wa Get unemployment benefits
    https://esd.wa.gov/unemployment
  106. Wa Get help starting a business
    http://www.oria.wa.gov/site/alias__oria/345/our_business_services.aspx
  107. Wa Find state laws and rules
    http://www.leg.wa.gov/lawsandagencyrules/Pages/default.aspx
  108. Wa Get power outage information
    http://wa.gov/topics/emergency/poweroutage.html
  109. Wa Business licensing
    http://business.wa.gov/get-or-renew-license
  110. Wa State Employee Directory
    http://dial.wa.gov/EmployeeDirectory/
  111. Wa Hunting or fishing licenses
    https://fishhunt.dfw.wa.gov/
  112. Wa Reporting new hires
    https://secure.dshs.wa.gov/dcsonline
  113. Wa Car tabs
    https://www.dol.wa.gov/vehicleregistration/renewyourtabs.html
  114. Wa Driver license
    http://www.dol.wa.gov/driverslicense/renew.html
  115. Wa Visitor Information
    http://wa.gov/topics/visiting.html
  116. Wa State Symbols
    http://www.leg.wa.gov/Symbols/Pages/default.aspx
  117. Wa State History
    http://wa.gov/topics/education/homeworkhelp/aboutwashingtonstate/history.html
  118. Wa Population Data
    http://www.ofm.wa.gov/pop/
  119. Wa Become a Resident
    http://wa.gov/topics/living/becomeresident.html
  120. Wa Product Recalls
    http://wa.gov/topics/consumerprotection/productsafetyrecalls.html
  121. Wa Suspect Fraud
    http://suspectfraud.wa.gov/
  122. Wa Food Stamps
    http://foodhelp.wa.gov/basic_food.htm
  123. Wa Medical Help
    http://www.hca.wa.gov/
  124. Wa Financial Aid Programs
    http://www.wsac.wa.gov/sfa-overview
  125. Wa Unclaimed Property
    http://ucp.dor.wa.gov/
  126. Wa Buy / Dispose Surplus
    http://www.des.wa.gov/services/Surplus/Pages/default.aspx
  127. Wa Privacy Notice
    https://privacy.wa.gov/privacywagov-privacy-policy
  128. Wa Public Disclosure Requests
    https://watech.wa.gov/Public-Disclosure-Requests
  129. Wa Accessibility Policy
    https://watech.wa.gov/accessibility-policy
  130. Wa Site Information
    http://wa.gov/siteinformation.html
  131. Wa Site Map
    http://wa.gov/home/sitemap.html
  132. Wa Contact Webmaster
    http://wa.gov/support/contact.html
  133. Wa RSS Feeds
    http://wa.gov/media/rss.html
  134. Wa FaceBook
    http://wa.gov/media/facebook.html
  135. Wa Twitter
    http://wa.gov/media/twitter.html
  136. Wa Flickr
    http://wa.gov/media/flickr.html
  137. Wa YouTube
    http://wa.gov/media/washington-state-youtube-channels.html

Links - Internal (nofollow)

0:

Links - Outbound

64:
  1. Wa Find Winning Lottery Results
    http://walottery.com/WinningNumbers/Default.aspx
  2. Wa Attorney General
    http://www.facebook.com/WAStateAttorneyGeneral
  3. Wa Commerce
    http://www.facebook.com/choosewashington
  4. Wa Employment Security
    https://www.facebook.com/WashingtonESD
  5. Wa Fish & Wildlife
    https://www.facebook.com/WashingtonFishWildlife
  6. Wa Governor Inslee
    http://facebook.com/WaStateGov
  7. Wa Health
    http://www.facebook.com/WADeptHealth
  8. Wa Insurance
    http://www.facebook.com/WSOIC
  9. Wa Labor & Industries
    http://www.facebook.com/laborandindustries
  10. Wa Licensing
    http://www.facebook.com/WSDOL
  11. Wa Natural Resources
    http://www.facebook.com/pages/WashingtonDNR/273352136518
  12. Wa Results Washington
    https://www.facebook.com/resultswa
  13. Wa Transportation
    http://www.facebook.com/WSDOT
  14. Wa Attorney General
    http://twitter.com/agowa
  15. Wa Fish & Wildlife
    https://twitter.com/wdfw/
  16. Wa Governor Inslee
    http://www.twitter.com/govinslee
  17. Wa Health
    https://twitter.com/WA_DeptofHealth
  18. Wa Insurance
    https://twitter.com/WAinsuranceblog
  19. Wa Labor & Industries
    https://twitter.com/lniwa
  20. Wa Licensing
    https://twitter.com/wa_dol
  21. Wa Natural Resources
    https://twitter.com/waDNR
  22. Wa Results Washington
    https://twitter.com/ResultsWA
  23. Wa Revenue
    https://twitter.com/wastatedor
  24. Wa Secretary of State
    https://twitter.com/secstatewa
  25. Wa Transportation
    https://twitter.com/wsdot
  26. Wa Conservation Commission
    http://www.flickr.com/photos/conservewa
  27. Wa Governor Inslee
    http://www.flickr.com/photos/GovInslee
  28. Wa Natural Resources
    http://www.flickr.com/photos/WAstateDNR
  29. Wa Puget Sound "Silent Crisis" Photo Challenge
    http://www.flickr.com/groups/pugetsoundpartnership/
  30. Wa Secretary of State
    http://www.flickr.com/photos/secstatewa/
  31. Wa State Library
    http://www.flickr.com/photos/wastatelib/
  32. Wa Superintendent of Public Instruction
    http://www.flickr.com/photos/waospi
  33. Wa Tourism
    http://www.flickr.com/groups/saywa_group/
  34. Wa Transportation
    http://www.flickr.com/photos/wsdot/
  35. Wa Washington National Guard
    http://www.flickr.com/photos/washingtonguard/
  36. Wa ECOconnect - Ecology
    http://ecologywa.blogspot.com/
  37. Wa Ear to the Ground - Natural Resources
    http://washingtondnr.wordpress.com/
  38. Wa L & I Blog - Labor & Industries
    http://deptoflaborandindustries.tumblr.com/
  39. Wa Licensing Express - Licensing
    http://licensingexpress.wordpress.com/
  40. Wa Money Talks - Financial Institutions
    http://www.finlit.blogspot.com/
  41. Wa Overseas with Lt. Governor Brad Owen
    http://www.overseaswithbrad.blogspot.com/
  42. Wa Washington Insurance Blog - Insurance Commissioner
    http://wainsurance.blogspot.com/
  43. Wa WSDOT BLOG - Transportation
    http://wsdotblog.blogspot.com/
  44. Wa Emergency Management Division
    http://www.wadisasternews.com/go/feed/1105/ru/rss20/
  45. Wa Financial Institutions, Dept. of
    http://finlit.blogspot.com/atom.xml
  46. Wa Lieutenant Governor's Office
    http://page2rss.com/rss/6dbf87ad2ac5050cbdb4d6129f765e06
  47. Wa Counties
    http://mrsc.org/Home/Research-Tools/Washington-County-Profiles.aspx
  48. Wa Northwest Indian Fisheries Commission
    http://nwifc.org/member-tribes/
  49. Wa Columbia River Inter-Tribal Fish Commission
    http://www.critfc.org/
  50. Wa Federal Government
    http://usa.gov/
  51. Wa U.S. House of Representatives
    http://www.house.gov/representatives/#state_wa
  52. Wa U.S. Senate
    https://www.senate.gov/senators/contact/senators_cfm.cfm?State=WA
  53. Wa National Parks in Washington State
    http://www.nps.gov/state/wa/index.htm?program=all
  54. Wa Governor's Facebook Page
    http://facebook.com/WaStateGov
  55. Wa Governor's Twitter Feed
    http://www.twitter.com/govinslee
  56. Wa Cities and Counties
    http://www.mrsc.org/cityprofiles/citylist.aspx
  57. Wa American Red Cross
    http://www.redcross.org/
  58. Wa Federal Emergency Management Agency (FEMA)
    http://www.fema.gov/
  59. Wa Washington Tourism Alliance
    http://experiencewa.com/
  60. Wa Find the winning lottery results
    http://walottery.com/WinningNumbers/Default.aspx
  61. Wa Traffic
    http://www.wsdot.com/traffic/
  62. Wa Weather
    http://www.wsdot.com/traffic/weather/
  63. Wa AMBER Alert
    http://www.amberalert.com/
  64. Wa Disaster News
    http://www.wadisasternews.com/go/site/1105/

Links - Outbound (nofollow)

0:

Keyword Cloud for Wa.gov

informationnatural resourceslabor ampstatelaborfeedsyouemergency managementfederalcountiesmedicaldirectorycommunitycommissionprivacylicensingnaturallegislaturesecretary of stateflickryourgovernorsstate of washingtonbusinesssiterssgovernorresultsnbsppagesnewvaronlinecontactmorehealthwildlifeattorney generaltransportation moreamp industrieslabor amp industriesdeptemergencypublicportalofficegovernmentgetlicensefishhelpgovernors officeindustries licensingstate governmenttransportation more stategeneralresourcesmore stateofficialsamp industries licensingfacebookgovernor insleecitiesinsuranceusagenciesservicesattorneytribalwashingtonampsecretaryfinancialtwitterindustriesfunctionemployeedatachannelinsleefindrss feedsblogvideosstate agenciestransportationwashington statenewsmanagementregistration

Longtail Keyword Density for Wa.gov

KeywordsOccurences
state of washington6
labor amp industries4
secretary of state4
amp industries licensing3
transportation more state3
washington state8
more state6
state agencies5
state government5
labor amp4
amp industries4
natural resources4
attorney general3
governor inslee3
industries licensing3
transportation more3
rss feeds3
emergency management3
governors office3
state45
washington25
government11
information10
business9
resources9
more8
amp7
governors7
news6
agencies6
licensing6
emergency6
governor6
help6
office5
transportation5
us5
blog5
feeds5
dept5
inslee4
insurance4
labor4
site4
industries4
natural4
twitter4
secretary4
fish4
rss4
management4
contact4
financial4
attorney4
function4
nbsp4
new4
services4
data4
public4
health4
license4
directory4
find4
results4
get4
online4
pages4
you4
officials4
facebook4
cities3
portal3
privacy3
your3
var3
community3
federal3
tribal3
legislature3
counties3
employee3
wildlife3
channel3
general3
videos3
commission3
flickr3
medical3
registration3

Who hosts Wa.gov?

Wa.gov Hosting Provider Information

Hosted IP Address:23.185.0.3
Hosted Hostname:23.185.0.3
Service Provider:OJSC Vimpelcom
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:nginx

Is "OJSC Vimpelcom" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
OJSC Vimpelcom
0.0346%

HTTP Header Analysis for Wa.gov

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Encoding: gzip
Content-Type: text/html
Etag: W/"5fa6e971-b842"
Last-Modified: Sat, 07 Nov 2020 18:37:37 GMT
Server: nginx
X-Pantheon-Styx-Hostname: styx-fe3-b-6776458c68-s5jpt
X-Styx-Req-Id: 9d2c598a-2128-11eb-bd57-86cb2a3f9c7d
Content-Length: 10958
Date: Sat, 07 Nov 2020 23:37:39 GMT
Connection: keep-alive
X-Served-By: cache-mdw17377-MDW, cache-lon4263-LON
X-Cache: HIT, MISS
X-Cache-Hits: 1, 0
X-Timer: S1604792260.595536,VS0,VE88
Vary: Accept-Encoding, Cookie, Cookie
Age: 160
Accept-Ranges: bytes
Via: 1.1 varnish, 1.1 varnish

Wa.gov Domain Nameserver Information

HostIP AddressCountry
puma.state.or.us 192.149.16.99
lion.state.or.us 192.149.16.131
nsoly1.wa.gov 147.55.186.3
nsspo1.wa.gov 147.55.114.3


Need to find out who hosts Wa.gov?


Domain Registration (WhoIs) information for Wa.gov

 % DOTGOV WHOIS Server ready
Domain Name: WA.GOV
Status: ACTIVE
Security Contact Email: Login to show email
Last update of whois database: 2020-08-14T07:35:21Z

Websites with Similar Names

Wa-101.com
线上真人国际-医院领导抗击疫情
Wa-academy.ru
????? ??????????????? ????? «?????»
Wa-accreditation.net
wa-accreditation.net
Wa-ae.com
bing – Daum ?? ??
Wa-al-anon.org
WA Area Alanon – Washington Area 59 Alanon

Recently Updated Websites

Zacharygraft.com (6 seconds ago.)Telescopeindonesia.com (7 seconds ago.)Yzhoubei10.com (9 seconds ago.)Xmfmq.com (11 seconds ago.)Zc962.com (12 seconds ago.)Zngsolutions.com (13 seconds ago.)Uykusetimodelleri.com (13 seconds ago.)T-breitmethod.com (15 seconds ago.)Velourswan.com (18 seconds ago.)Xykwenz.com (19 seconds ago.)Ykkjt.com (20 seconds ago.)Zhua-shu.com (32 seconds ago.)Xmffk.com (32 seconds ago.)Thatsmmymortgage.com (33 seconds ago.)Virtualnotaryfl.com (35 seconds ago.)Yousdai.com (37 seconds ago.)Znl001.com (37 seconds ago.)Veroniqueleducphotographie.com (40 seconds ago.)Yourcreditperfection.com (42 seconds ago.)Usbankfa.com (43 seconds ago.)Unsecuredcredit1.com (43 seconds ago.)Vibesofwealth.com (46 seconds ago.)Vgosdraysscuticn.com (47 seconds ago.)Wadaimap.com (49 seconds ago.)Yubagoldaccounting.com (52 seconds ago.)Vallonenergy.com (55 seconds ago.)Xmffh.com (56 seconds ago.)Tynemouthmarkets.com (59 seconds ago.)Upcotdigipay.com (59 seconds ago.)Yunjiangkeji.com (1 minute 1 second ago.)

Recently Searched Keywords

宠爱 (1 second ago.)阿迪妮·威拉丝缇 (1 second ago.)vanamali (2 seconds ago.)sino-india (2 seconds ago.)技术研发工程师 (2 seconds ago.)天使陷落 (3 seconds ago.)arts at 2019 (3 seconds ago.)出轨的话就死定了 (3 seconds ago.)management (5 seconds ago.)1999729916352703905710511111519979367332343335013 (5 seconds ago.)gmt gmt 2020-05-15 (6 seconds ago.)e-liquid (6 seconds ago.)妻子的浪漫旅行第四季 (7 seconds ago.)hd1280高清中字版 (7 seconds ago.)chinese army claims to have ‘found’ the five missing arunachal youths reported abducted by it (7 seconds ago.)tibetanmastiff-com (9 seconds ago.)china watch (9 seconds ago.)项目经理 (10 seconds ago.)7nbsp3952nbsp480nbsp-nbsp494 (10 seconds ago.)重庆渝和电力勘察设计有限... (10 seconds ago.)product weight lt (11 seconds ago.)tibet news (11 seconds ago.)湃思科工程技术(中国)有... (13 seconds ago.)wordpress events rss (15 seconds ago.)no bail for new york cop caught spying on tibetans (15 seconds ago.)toptoptopmegaprofit (17 seconds ago.)etpbpromobuttonetpbbuttoncolor0072ffimportantborder-width0pximportantletter-spacing4pxfont-size14pxfont-familybungeedisplayimportantbody page-container (19 seconds ago.)theandric action (21 seconds ago.)vk менеджер (23 seconds ago.)gitschberg jochtal (23 seconds ago.)